(data stored in ACNUC7421 zone)

EMBL: CP001743.PE249

CP001743.PE249       Location/Qualifiers
FT   CDS_pept        complement(222149..222802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27031"
FT                   /protein_id="ADD27031.1"
FT                   /translation="MKKLLAIAFLSLGLAMAQSIAEITRQVQANMERSPWEATVTGKVQ
FT                   LPDGSTQEADFRLQVIPGKEQLARVEFKKPAALEGNFVVISDKEVWNYLFLTNQLIIQP
FT                   RAKARIEGLGFNLTDLGDFEELTQRVTLRLLGEQNTPAGPAWRIGGAPKDASLGFASME
FT                   ILVLKSDPRPLSITLRDSSNKVLADLNLTNFRRANLTPQTLRKRPADAEVLRRN"
     atgaaaaaac tgctagcaat cgccttctta tcccttgggc tggctatggc ccagagcatc        60
     gccgaaatta cccgccaggt gcaggccaac atggaacgtt cgccctggga ggccaccgtc       120
     acgggcaagg tgcagctacc cgacggcagc acccaggagg ccgatttccg gctccaggtg       180
     attccgggca aggagcagct cgcccgggtc gagttcaaaa aacccgccgc cctcgagggc       240
     aacttcgtgg tgatctcgga taaggaagtc tggaactacc tgttcctgac caaccagctc       300
     atcatccagc cccgcgccaa agcccgcatc gaaggcctgg gcttcaacct gaccgacctc       360
     ggcgacttcg aggagctcac ccagcgggtc acgctgcggc ttctgggcga gcaaaacacc       420
     cccgccggcc cggcctggcg cattggcggc gcccccaagg acgcctcgct gggctttgcc       480
     agcatggaaa ttctggtgct caagtccgac ccccgccccc tctccatcac cctgcgcgac       540
     agcagcaaca aggtgctggc tgaccttaat ctcaccaact tccgccgggc caacctaacc       600
     ccccagaccc tgcgcaagcg gcccgccgat gccgaggtgc tgcggcgcaa ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page