(data stored in ACNUC7421 zone)

EMBL: CP001743.PE250

CP001743.PE250       Location/Qualifiers
FT   CDS_pept        complement(222799..223650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27032"
FT                   /protein_id="ADD27032.1"
FT                   /translation="MKGFHPYRRLLQLALAAVGLQLSTLGLGQSLTFGLFGRLSPDHLT
FT                   PTLEATLPLGELELRARLQRDALGLGLNGALELSALGRLSYGAGFSLGFAGWGLQAGAS
FT                   AVLGPVAASLEALYSTTPRSSLWVGDEAEGGLKLGLGGRYRLEPRQTLGLQLGFKNSLA
FT                   GIASGSGELSYALRQEQTYTFGLGVDDSRLYGLLGWRGELDEAGTLLEATLRAGQLNRL
FT                   EAALTTPLDEEQLNNLKLRLTVAYPWAATLGVEAYGFRADASYDGGFSLWLRYILEFGG
FT                   NE"
     atgaaaggat ttcacccata ccgacgtctc ctgcaactcg ccctggcggc ggtgggtcta        60
     cagctttcga ccctcggcct tgggcagtcc ctcaccttcg ggctttttgg ccgcctgtcg       120
     cccgaccacc tgacccccac cctcgaggcc acccttccgc tgggcgagct ggagctacgc       180
     gcacggctgc agcgcgatgc gctgggcctg gggttgaacg gcgcgctgga gctaagcgcc       240
     ctgggccggc tgagctacgg cgcaggcttt agcctgggct tcgccggctg gggcttgcag       300
     gccggggcca gcgccgtcct gggcccggtg gccgccagcc tggaggcgct gtacagcacc       360
     accccgcgct cgagcctgtg ggtgggcgac gaggccgaag gcgggctgaa gctggggctg       420
     ggcgggcgct accgcctcga gccccggcag accctgggcc tgcaactggg cttcaaaaac       480
     agcctggcgg gtatcgccag cggttcgggg gagctgagct atgccctgcg acaggaacag       540
     acctacacct ttgggctggg ggtggacgat tcgcgcctgt acggcctctt gggctggcgg       600
     ggtgagctgg acgaggccgg gacgctgctc gaggccaccc tgcgggccgg gcagctcaac       660
     cggctggaag cagccttaac cacgccttta gacgaggagc agctcaacaa tcttaagctg       720
     cgcctaaccg tggcctaccc ctgggctgct accctggggg tggaggccta cggcttccgc       780
     gccgatgcaa gctacgacgg tggattttcc ctatggctaa ggtacatcct cgagttcgga       840
     ggtaatgaat ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page