(data stored in ACNUC7421 zone)

EMBL: CP001743.PE251

CP001743.PE251       Location/Qualifiers
FT   CDS_pept        complement(223708..224829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0255"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; SPTR: A7M0U3 Putative
FT                   uncharacterized protein; InterPro
FT                   IPR013526:IPR013525:IPR000412; COGs: COG0842 ABC-type
FT                   multidrug transport system permease component; KEGG:
FT                   smt:Smal_1356 ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27033"
FT                   /protein_id="ADD27033.1"
FT                   /translation="MSRILALAQKEFTQIRRDHVLSRLIVGLPIVMTLLFGYAINFTLS
FT                   GIRLAVYDGSQDRISQYLLQELQKENRFTLTHIAQNPAEVPQAIQKNQARVGLVIPSGA
FT                   LQAVRQDKAVQLEVFVDGADPNFAFQAQAALRKVLGDVNSRLLAGKVLAGTATTPPLTP
FT                   SLHTLYNPDNKTAWFTIPGIIGLIMTIFTVLLTALSIVRENEGRTMEALMASPIKPYEV
FT                   VLGKVLPYFVIATLVSLVVLSIGHWVFGVPVRGSLLLLFGLIVLFVLGSLGVGVLISTL
FT                   ARTQIQAVFGTFAYILPTIFLSGFVFPVDGMPLLFRWLAAVIPARYLIDGTRGVMLRGA
FT                   GLETLWVDLVALVIFSVAVLGLASLRFGKRLAA"
     atgagccgca tcctggccct ggcgcaaaag gagttcaccc agatccgccg cgatcacgtg        60
     ctgtcccggc ttattgtggg gctgcccatc gtcatgaccc tgctgttcgg ctacgccatc       120
     aacttcaccc tctcgggcat ccgcctggcc gtctacgatg gctcgcagga tcgcatcagc       180
     cagtacctgc tgcaagagct gcaaaaggaa aaccgcttta ccctcaccca catcgcacaa       240
     aacccggcgg aggtgccgca ggccatccag aaaaaccagg cccgggtcgg cctggtgatt       300
     ccttcgggcg ccctgcaagc cgtgcggcag gataaagccg tacagctcga ggtgtttgtg       360
     gatggcgccg accccaactt tgccttccag gcccaggccg ccctgcgcaa ggtgctggga       420
     gacgtcaaca gccgcctgct ggccggcaag gtgctggccg gaaccgccac caccccgccc       480
     ctcaccccca gcctgcacac cctctacaac cccgacaaca aaaccgcctg gtttaccatc       540
     ccgggcatca tcggcctgat tatgaccatc tttacggtgc tcctgaccgc gctttcgatc       600
     gtgcgcgaaa acgagggccg caccatggag gccctgatgg ccagccccat caaaccctac       660
     gaggtggtgc tgggcaaggt gctgccctat tttgtgatcg ccaccctggt gagcctggtg       720
     gtgctctcga tcgggcactg ggtgtttggc gtgccggtgc gtgggagcct gctgctgctc       780
     tttgggctga tcgtgctctt cgtgctgggc tcgctggggg tgggggtgct gatctccacc       840
     ctggcccgca cccagattca ggcggtgttt ggcacttttg cctacatcct gcccaccatc       900
     tttctttcgg ggtttgtgtt ccccgtagat ggcatgcccc tgctgttcag gtggttggca       960
     gcggtgattc cggcccgcta tctgattgat ggcacgcggg gggtaatgct ccggggcgcg      1020
     ggcctcgaga ccctctgggt agacctggtg gcgctcgtca ttttcagcgt ggccgtgctg      1080
     ggtctggcca gcctgcgctt tggcaaacgg ctggcggcct ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page