(data stored in ACNUC7421 zone)

EMBL: CP001743.PE255

CP001743.PE255       Location/Qualifiers
FT   CDS_pept        227049..227480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0259"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: A0ZMK0 Putative uncharacterized protein
FT                   (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27037"
FT                   /protein_id="ADD27037.1"
FT                   /translation="MALQQRIESLLRALGVPDLNVEVPSVADEEGFLEALEAAITSFVE
FT                   DGEDDQSPLGLIEADPSAYDLSDEPDHEELQNAVRDFMNAGDSQLTLITPESPIQPDGG
FT                   ENPSKFWVFLLQMPSLSEHRWWAIVDKNGRHDTYNYGVI"
     atggccttgc aacagcgaat agaatccttg ctgagagcgc tgggggtgcc cgacctgaat        60
     gtcgaggtac cttctgtggc cgacgaagag ggctttctcg aggccctcga ggcggccatt       120
     accagctttg tggaggatgg cgaggacgac caaagccccc tgggcctgat cgaggccgat       180
     ccttcggcct acgacctctc cgacgaaccc gatcacgagg agctgcaaaa tgctgtgcgg       240
     gacttcatga atgcgggcga ttcccagctc accctgatca cccccgaaag ccccatacag       300
     cccgatggcg gcgagaaccc cagcaagttc tgggtgtttc tgctccagat gccctcgctc       360
     tccgaacacc gctggtgggc cattgtggac aagaatggcc gccacgatac ctacaactac       420
     ggggtcatct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page