(data stored in ACNUC7421 zone)

EMBL: CP001743.PE256

CP001743.PE256       Location/Qualifiers
FT   CDS_pept        complement(227516..228511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0260"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein A;
FT                   PFAM: Radical SAM domain protein; molybdenum cofactor
FT                   synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; InterPro
FT                   IPR010505:IPR007197:IPR006638:IPR013483; KEGG:
FT                   dal:Dalk_2755 molybdenum cofactor biosynthesis protein A;
FT                   COGs: COG2896 Molybdenum cofactor biosynthesis protein;
FT                   SPTR: A5CYZ0 Molybdenum cofactor biosynthesis protein A;
FT                   PFAM: Radical SAM superfamily; Molybdenum Cofactor
FT                   Synthesis C; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27038"
FT                   /protein_id="ADD27038.1"
FT                   /translation="MQHGVASVKLTDQYGRIIKDLRLSVTPRCNLHCLYCHPLGWEQSE
FT                   PPGTISVEDTRHFLRAMQLLGLESVRFTGGEPLVRKELPQMIAAASELGIPDIAITTNG
FT                   LLFKRKARELLSAGLKRINLSMDAVTPEVFRSMTRGGQVEKVWEAIETAWELGMHPVKI
FT                   NAVMIRGMNEQEVIPLAALSLDKPLEVRFLEYMHLDNSNPELYHARFISGAETRARIEA
FT                   HFGPLERVDHDPTAPARVYHIPGAVGTVGFINPVTEPFCSKCSRLRLTADKKIRPCLLT
FT                   DLEMDIAWAFEAENPVEALVDAILLATDRKPAFGNTLPTLRERVMVGIGG"
     gtgcaacacg gggtggccag cgtgaaacta accgaccaat acgggcgcat catcaaagac        60
     ctgcggcttt cggtcacgcc gcgctgcaac ctgcactgcc tgtactgcca tccgctgggc       120
     tgggaacagt cggaaccccc cggcaccatc tcggtcgagg acacccgcca ctttttgcgg       180
     gccatgcagc tactggggct ggaatcggtg cgctttaccg gcggcgagcc gctggtgcgc       240
     aaagagctgc cccagatgat tgcagcagcc agcgagctgg gcatccccga catcgccatc       300
     accaccaacg gcctcctgtt caagcgcaag gccagggagc ttctaagcgc tgggctcaaa       360
     cggattaacc tctcgatgga cgcggtgacc cccgaggtct tccgcagcat gacccggggt       420
     gggcaggtcg agaaggtctg ggaggccatc gaaaccgcct gggagctggg catgcacccg       480
     gtcaaaatca acgcggtgat gatccggggc atgaatgaac aggaggtaat tccgctggcc       540
     gcactctcgc tggacaaacc cctcgaggtg cgcttcctgg agtacatgca cctcgacaac       600
     tccaaccccg agctctacca cgcccgcttt atcagcgggg ccgagacccg cgccagaatc       660
     gaggcccact ttggccccct cgagcgcgta gaccacgatc ccaccgcccc cgcgcgggtt       720
     tatcacatcc ccggcgcggt gggtacggtg ggctttatca acccggttac cgagcctttt       780
     tgctccaagt gctcccgcct gcgcctgacc gccgacaaaa aaatccggcc ctgcttgcta       840
     accgacctgg agatggacat tgcctgggcc ttcgaggccg agaaccctgt tgaggccctg       900
     gtagacgcca tcctgctggc caccgaccgc aaaccggcct tcggcaacac cctgcccacc       960
     ctgcgcgagc gggtgatggt gggcattggc ggctaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page