(data stored in ACNUC7421 zone)

EMBL: CP001743.PE260

CP001743.PE260       Location/Qualifiers
FT   CDS_pept        complement(230984..232168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0264"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; SPTR: A3HXQ9
FT                   Butyryl-CoA dehydrogenase;
FT                   InterProIPR006090:IPR006092:IPR006091:IPR013107:IPR 006089;
FT                   COGs: COG1960 Acyl-CoA dehydrogenase; KEGG: acp:A2cp1_2299
FT                   acyl-CoA dehydrogenase domain protein; PFAM: Acyl-CoA
FT                   dehydrogenase, N-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27042"
FT                   /protein_id="ADD27042.1"
FT                   /translation="MIADRPRDLWFELDSEERQIIGTLRDFLQAEVAPTAAERDETGAF
FT                   PFEIVKKLGEMGVMGAQVPEQYGGAGLSTRVFARIIEEIAAVDGSLALTVASHNSLCTG
FT                   HILIAGNEQQKRQFLPRLASAEVLGAWGLTEPGSGSDAAAMRTKAEDTGSSWVLNGTKQ
FT                   FITQGSVAGVYVVNARTDAAPSEEKKHLGLSALVFEAPIPGLRIGRKERKLGLNASDTA
FT                   QIIFEDITLPKEALLGERGRGFYDVMRVLEGGRIGIAAMAVGLGRAALEFATKYALERE
FT                   QFGRPIAEFQAVSHKLADMATQLEAARLLYLKAAELRDAGKPFGPAAAQAKLFASEVAV
FT                   QACDEAIQILGGYGYIKEYPVERYWRDARLTRIGEGTSEVLKVIIAKHLLAQYR"
     atgattgccg atcgccccag ggacttatgg tttgagcttg atagcgagga acgccagatt        60
     atcggtacgc tgcgggattt tttgcaggcc gaggtggccc ccaccgccgc cgagcgcgac       120
     gagaccggcg cctttccgtt tgaaatcgtg aagaagctgg gcgagatggg tgtgatggga       180
     gcccaggtac ccgagcagta cggcggggcg gggctatcca cgcgcgtttt tgcccgcatt       240
     atcgaagaaa ttgcagcggt agatggttcg ctggcgctta ccgtggcctc gcacaacagc       300
     ctgtgtaccg gccatatcct gattgccggc aacgagcagc agaagcggca attcctgccc       360
     cggctggctt ccgccgaggt gctgggggcc tggggcctca ccgagccagg cagcggctcg       420
     gacgccgcgg ccatgcgcac caaagccgaa gacaccggct cgagctgggt gctgaacggt       480
     accaagcagt tcatcaccca ggggtcggtg gccggggtgt atgtggtcaa cgcccgcacc       540
     gatgccgccc ccagcgagga gaaaaagcat ctggggctct cggcgctggt gttcgaggcc       600
     cccattccag gcttgcggat tgggcgcaag gagcggaagc tagggcttaa cgcttcagac       660
     accgcgcaga taatctttga ggatattacc ttgcccaaag aggccctgct gggtgagcgg       720
     ggcaggggct tctacgatgt gatgagggtg ctggaaggcg ggcgcatcgg catcgctgcc       780
     atggcggtgg ggctggggcg ggccgctctg gagtttgcta ccaagtacgc cctcgagcgc       840
     gaacagtttg gcaggcccat cgccgagttc caggcagtct cacacaagct ggccgatatg       900
     gctacgcagc tagaagccgc ccggctcttg tacttgaagg ccgccgaact gcgcgacgcc       960
     ggtaagccct tcggcccggc tgcggcccag gccaagctct tcgcctcgga ggtggcggtg      1020
     caggcctgcg acgaggccat ccagattcta ggcggctatg gctacatcaa ggagtacccg      1080
     gtcgagcgct actggcgcga cgcccgcctg acccgcatcg gggagggcac cagcgaggtg      1140
     ttgaaggtga tcatcgccaa gcacttgctg gcccagtacc gctag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page