(data stored in ACNUC7421 zone)

EMBL: CP001743.PE261

CP001743.PE261       Location/Qualifiers
FT   CDS_pept        232371..232748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0265"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; InterPro IPR003029; KEGG:
FT                   bsu:BSU00630 hypothetical protein; COGs: COG1098 RNA
FT                   binding protein (contains ribosomal protein S1 domain);
FT                   SPTR: A6NQP1 Putative uncharacterized protein; PFAM: S1 RNA
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27043"
FT                   /protein_id="ADD27043.1"
FT                   /translation="MELEAGAIVEGRVTRIMEFGAFVEFPNGESGLVHISQVAHEFVKN
FT                   IRDHLNEGDVVSVLVLGRDEKGRLDLSIKELTPAPVEPPRPKRLPRQAPDFENKLKSFL
FT                   RGSGGFGGGKKPGGKGGRKRR"
     atggagcttg aagccggtgc aatcgtagaa ggtcgtgtta cgcgaattat ggagttcggg        60
     gcttttgtgg agtttcccaa cggcgagtcg ggtctggtgc atatctcgca ggtggcccac       120
     gagttcgtca agaacatccg cgaccatttg aatgaagggg atgtggtctc ggtgctggtt       180
     ttggggcgcg acgagaaggg ccgcctggat ctttccatca aggagctgac cccagcccca       240
     gtggagcccc cccggcccaa gcgcttgccc cgccaggccc ccgattttga gaacaaactc       300
     aaaagctttt tgcgtggctc gggaggtttt ggtggcggta aaaagcccgg cggcaaggga       360
     ggacgcaaac gccgctag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page