(data stored in ACNUC7421 zone)

EMBL: CP001743.PE265

CP001743.PE265       Location/Qualifiers
FT   CDS_pept        234860..235063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0269"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pde:Pden_4705 putative transmembrane protein;
FT                   SPTR: A3JYR6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27047"
FT                   /protein_id="ADD27047.1"
FT                   /translation="MIPNVGSTDRLVRYILAAVFFLIAFFGSGGVWAWVFGLLGVVMVV
FT                   TATLNFCPIWAAFKINTRGKAS"
     atgattccca acgtaggcag cacagatcgg cttgttcgct acatcctggc ggcggtgttt        60
     ttcctgatcg cttttttcgg tagtggcggc gtctgggcct gggtgtttgg gctgctgggg       120
     gtggtcatgg tggtaaccgc taccctcaat ttctgcccca tctgggcggc attcaagatt       180
     aatactcgag ggaaagcctc ttaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page