(data stored in ACNUC7421 zone)

EMBL: CP001743.PE267

CP001743.PE267       Location/Qualifiers
FT   CDS_pept        complement(237283..237918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_3344 hypothetical protein; SPTR:
FT                   A6CL78 YtxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27049"
FT                   /protein_id="ADD27049.1"
FT                   /translation="MFAITTPEEADAFIDSKPITAIFKAGTCHKTMQGWGNVEKMLRER
FT                   PEIPVGIIKVVEHRPASNRVAERTGIVHHSPQIILFRNGQPLFELNNWEITLENLEALF
FT                   QQHLPDVKVEPAQEGGRSNLEPYKRLLDAYLSGAISEQQFAWAYLNMFREDASLRSQEE
FT                   FELLNSLFGNPDEHHIHPMTILQFEQANPQATPLFERAQHLRARLDTL"
     atgttcgcca tcaccacccc cgaagaggcc gacgctttta tcgacagcaa acccatcacg        60
     gccatcttca aggccggcac ctgccacaag accatgcagg gctggggcaa cgtcgaaaaa       120
     atgctgcgcg agcggcccga aattccggtg ggcatcatca aggtggtgga gcaccgccca       180
     gcctcgaacc gggtggccga gcgcaccggc attgtgcacc actccccgca aattattctg       240
     ttccgcaacg gccagccgct cttcgagctg aacaactggg agatcaccct ggaaaacctc       300
     gaggccctct tccagcaaca cctcccggat gtaaaagtcg aacccgcaca agaagggggt       360
     agaagcaacc tcgagcccta caagcggctt ctggacgcct acctgagcgg agcaatcagc       420
     gagcagcagt tcgcctgggc ctatctcaac atgttccgcg aggacgcctc gctgcgctca       480
     caggaggagt tcgaactgct caactccctg tttggcaatc ccgacgagca ccacatccac       540
     cccatgacca tcctgcagtt tgagcaagcc aacccccagg ccacgccgct atttgagcgc       600
     gcccaacacc tgcgggcccg cctcgacaca ctctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page