(data stored in ACNUC7421 zone)

EMBL: CP001743.PE268

CP001743.PE268       Location/Qualifiers
FT   CDS_pept        complement(237985..238719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0272"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; SPTR: A6CR03 Putative
FT                   uncharacterized protein; InterPro IPR003737; COGs: COG2120
FT                   conserved hypothetical protein LmbE homologs; KEGG:
FT                   aba:Acid345_2880 LmbE-like protein; PFAM: GlcNAc-PI
FT                   de-N-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27050"
FT                   /protein_id="ADD27050.1"
FT                   /translation="MIEPMDLLVVVPHPDDEVFGAGGTLIQYADWGLETGLITLTKGEA
FT                   GRTLGLCRPEELGELRAQELQRAAQILKLGHLELYDFPNGLPNNPVDGEARGHGFSTPQ
FT                   GVADHPEIVDLLLWRLEVLRPRAIITFGPNGSNRHPDHVATHRFVVKAVEKSGQKIKLF
FT                   FYASPQPLPEYLEGWLPPNHVRHLPMEVLLQKLRAMAQHRTQALSVLNFMDRFSSRLAS
FT                   ETFHLAGYEGPIQHELLWYARP"
     atgatagagc ccatggactt gctggtggtg gtgcctcacc ccgacgacga ggtgttcggc        60
     gcaggcggaa cgctcattca atacgccgac tgggggctgg agaccggcct gatcaccctt       120
     accaaaggcg aggccgggcg aaccctgggg ctgtgcaggc cggaggagtt gggtgaactg       180
     cgagcccagg agctacagcg ggcggcgcaa attctcaaac tgggccacct cgagctctac       240
     gattttccca atggtctgcc caacaacccg gtggacggcg aagccagggg ccacggtttt       300
     tccaccccgc agggcgtggc cgatcacccc gaaattgtcg atttgctgct gtggcgtttg       360
     gaggtgctgc gccccagggc catcattacc tttggcccca atggctccaa ccgccacccc       420
     gaccacgtcg ccacccatcg gtttgtggtg aaggccgtag aaaagtccgg acagaagatc       480
     aagctattct tctacgcttc cccgcagccg ctgccggagt acctggaggg ctggctgccc       540
     cccaaccatg tgcgccacct gcccatggag gtgctgctgc aaaagctgcg ggccatggcc       600
     cagcaccgca cccaggccct ctcggtgctc aactttatgg atcgctttag ctcccggcta       660
     gccagcgaaa ccttccacct agcaggttat gaagggccca tacaacacga actgctctgg       720
     tatgcccggc cttag                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page