(data stored in ACNUC7421 zone)

EMBL: CP001743.PE269

CP001743.PE269       Location/Qualifiers
FT   CDS_pept        complement(238753..239889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kpn:KPN_03266 translocation protein TolB
FT                   precursor; SPTR: A4BHR6 Oligogalacturonate lyase; PFAM:
FT                   WD40-like Beta Propeller Repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27051"
FT                   /protein_id="ADD27051.1"
FT                   /translation="MRQFRDPRTGRLITQLTDRGNNVHLYFTENAFDLTRPEIIFRSDR
FT                   AAKQERAPHENPHYNLFRLNYLTGEITQLTDEDQPVGSVTKTPDSELIAYLTAGKVKLL
FT                   NTRTGKTTVLYEDKGDYNLYSPSISPNRRYVGFARNERVKAVNTNVNYGGFKESFYQIK
FT                   DGRITLARTDGSSWFDVHCDTHWLGHFQFAPDDPTLAMFCHEGPWNLVTQRIWLLDLAA
FT                   RQVKPIFRQDEQDSVGHEFWTQDGLIFFDNRGPGHDGTITSAKTQAVVQSPSPDNFRPY
FT                   VGLMDREGRLVRRIEMPFYCNHYHANPSNTLLVGDDADNLVLIDISGEQARLEVLCEHG
FT                   TSWHTQASHCHPTWSWDGKRILYASDRGGRVNLYLLEL"
     atgcgccagt tccgcgaccc tcgaaccggt cggctcatca cccagctcac cgaccgaggg        60
     aacaacgtac acctctactt caccgaaaac gccttcgacc tcacccggcc cgagatcatc       120
     ttccgctcag accgggccgc caagcaggag cgcgccccac acgaaaaccc gcactacaac       180
     ctctttcgcc tgaactacct gaccggcgag atcacccagc ttaccgacga agaccagccg       240
     gttggcagtg tcaccaaaac ccccgacagc gagctgatcg cctacctgac ggccggaaag       300
     gttaagcttt tgaacacccg caccgggaaa accaccgtgc tttacgaaga caaaggggac       360
     tacaacctct actccccttc gatcagcccc aaccgccggt atgtggggtt tgcccgcaac       420
     gaacgggtta aggccgtcaa caccaacgtc aactacgggg gctttaagga gagtttctat       480
     cagatcaagg atgggcgcat caccctggcc cgcaccgatg gctcgagctg gttcgacgtc       540
     cactgcgaca cccactggct ggggcatttc cagttcgcac cggacgatcc caccctggct       600
     atgttttgcc acgaaggccc ctggaacctg gtaacccagc gcatctggct gctcgacctg       660
     gccgcccggc aagtaaaacc catctttcgc caggatgagc aggactcggt cggccacgag       720
     ttctggaccc aggatgggct gattttcttc gataaccgcg gccccggcca cgacggcacc       780
     atcacctccg ccaagaccca ggcggtggtg caatccccct ctccagacaa cttccgtcca       840
     tatgtgggcc tgatggatcg cgaagggcgg ctggtacgcc ggatcgagat gcctttttac       900
     tgcaaccatt accacgccaa cccctccaac accctgctgg tgggcgatga tgccgacaac       960
     ctggtgctca tcgatatctc cggggagcag gcccggctcg aggtgctgtg cgagcacggc      1020
     acctcctggc acacccaggc cagccactgc caccccacct ggagctggga cgggaagcgc      1080
     attctctatg cttccgaccg gggcgggcgg gtcaacctgt atctgctcga gctctga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page