(data stored in ACNUC7421 zone)

EMBL: CP001743.PE270

CP001743.PE270       Location/Qualifiers
FT   CDS_pept        complement(239945..240280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0274"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; SPTR:
FT                   A7JXZ4 Possible pectin degradation protein; KEGG:
FT                   kpn:KPN_03255 hypothetical protein; COGs: COG1917 conserved
FT                   hypothetical protein contains double-stranded beta-helix
FT                   domain; InterPro IPR013096; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27052"
FT                   /protein_id="ADD27052.1"
FT                   /translation="MQLNGDWEAVEPGIERRLVALGQRMMAVRVRFAKGAAGTAHTHPH
FT                   EQLTQVLSGRFRFWLGQEAREVVAGESLLIPGGLEHGAEALEAGELLDVFSPLREDLLD
FT                   GPTAHPE"
     atgcagttga acggagattg ggaagccgtg gaaccaggca tcgaacgccg gctggtggct        60
     ttaggccagc gcatgatggc ggtgcgggtt cgttttgcta aaggcgcagc aggcaccgcg       120
     cacacccacc cacacgagca gcttacccag gttctgagcg gacgcttccg cttctggctg       180
     ggccaggagg cgcgggaggt ggttgcgggt gaaagcctgc tcatccccgg cggcctcgag       240
     cacggcgccg aggcgctgga ggcgggggaa ctgctcgatg tgttctcccc tctgcgcgaa       300
     gatctgctcg atggccccac cgcccatccg gagtag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page