(data stored in ACNUC7421 zone)

EMBL: CP001743.PE272

CP001743.PE272       Location/Qualifiers
FT   CDS_pept        complement(241225..241866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0276"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; InterPro IPR000887; KEGG: scl:sce1239
FT                   hypothetical protein; COGs: COG0800
FT                   2-keto-3-deoxy-6-phosphogluconate aldolase; SPTR: A6CCL1
FT                   Putative uncharacterized protein; PFAM: KDPG and KHG
FT                   aldolase; TIGRFAM: Entner-Doudoroff aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27054"
FT                   /protein_id="ADD27054.1"
FT                   /translation="MSQPNFMQTLAAARVVGILRSSTSTAAVEAALAAVRAGLQVLEVT
FT                   FTTPGALEVLRTLRQQLPEHVRLGAGTVMTAEEGRAALEAGAEFLVSPHLGEDLLALAS
FT                   ETGVPYLPGVLTPSEIVRALGLGAQMVKVFPAGSSGGLAYIKDLLGPLPHLKILATGGI
FT                   RPGEVPAYLQAGVWAVGLGSNLFPKAALERGDWAAVEAAARQALAEAGVA"
     gtgagccaac ccaacttcat gcagaccctg gccgcggccc gggtggtggg cattctgcgc        60
     agcagcacat ccactgcggc ggtggaagcg gcgctggcgg ccgtgcgggc cggtttgcag       120
     gttctcgagg ttacctttac cacccccggc gccctcgagg tcctgcgcac actgcgccag       180
     caactccccg aacacgttcg actgggggcc ggtacggtca tgacggcaga ggaaggacgc       240
     gccgccctcg aggccggcgc ggagtttctg gtcagccccc acctgggcga ggatctgctg       300
     gccttagcca gcgaaacggg tgtgccctac ctaccggggg tgctgacccc cagcgagatt       360
     gtgcgggccc tgggcctggg ggcccagatg gtcaaggttt ttccggcggg ctcgagcggg       420
     ggcctggcct acatcaagga cttgctgggg cctttgcccc atctgaagat tctggctacc       480
     gggggtatcc ggcccggcga agtaccggct tacctccagg cgggggtctg ggcggtgggt       540
     ctgggctcca acctctttcc caaggcagcg ctcgagcgag gcgactgggc ggccgtcgag       600
     gccgccgccc gccaggccct ggcggaagcg ggggttgcat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page