(data stored in ACNUC7421 zone)

EMBL: CP001743.PE274

CP001743.PE274       Location/Qualifiers
FT   CDS_pept        complement(242644..243441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0278"
FT                   /product="Myo-inositol catabolism IolB domain protein"
FT                   /note="PFAM: Myo-inositol catabolism IolB domain protein;
FT                   SPTR: A1HM17 Myo-inositol catabolism IolB domain protein;
FT                   InterPro IPR010669; COGs: COG3718 Uncharacterized protein
FT                   involved in inositol metabolism; KEGG: sus:Acid_1480
FT                   myo-inositol catabolism IolB domain-containing protein;
FT                   PFAM: Myo-inositol catabolism protein IolB"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27056"
FT                   /protein_id="ADD27056.1"
FT                   /translation="MKYFHTIPQGSGLLPLADEACQLLAFAKLNLEAGQSYEGETGERE
FT                   ILLVALSGKAELEVGGRKFAPIGGRPSVFAGSPHSVYLPRGQRFRVRALTRFEAALPSA
FT                   PSDLETEPYEIRPEQVNTGRWGTLNFTRQFREILVEPDGRPASRLIVGETITPSGNWST
FT                   YPPHKHETAQGSEVFHEEMYYFRISSPEGWGLTRHYSPERGYDQTYVVKDETLLSIPHG
FT                   YHTYVSAPGYTGYYLWFLAGDGRRQGVRFDPDLAWVQKTVGMV"
     atgaagtact ttcacaccat cccccaaggt tcgggcctcc tgccccttgc cgacgaggcc        60
     tgtcaactgc tggccttcgc caagctcaac ctcgaggccg gccagagcta tgagggcgag       120
     accggcgagc gcgagatact gctggtggcg ctctccggca aagcggagct cgaggtgggc       180
     gggcgaaagt ttgccccgat cggtggccgg cccagtgtgt tcgcgggcag cccccacagc       240
     gtttacttac ctcgaggcca gcgcttccgg gtgcgcgccc ttacccgctt cgaggccgcc       300
     ctgccctccg cccccagcga tctggagacc gagccctacg aaatccgccc cgagcaggtg       360
     aacaccggcc gctggggcac cctgaacttc acccgccagt tccgggaaat cctggttgaa       420
     cccgatgggc gcccggccag ccgcctgatc gtgggcgaga ccatcacccc cagcggcaac       480
     tggagcacct acccgcccca caaacacgaa accgcccagg ggagcgaggt attccacgaa       540
     gagatgtact atttccgcat ctcctccccg gaaggctggg ggctgacccg ccactacagc       600
     cccgagcgcg gctacgacca gacctatgtg gtgaaggacg agaccctgct ctccattccg       660
     catggctacc acacctacgt gagcgccccc ggctacaccg gctactacct gtggttcctg       720
     gccggcgacg ggcggcggca gggggtgcgc ttcgaccccg acctggcctg ggtacagaaa       780
     accgtgggca tggtgtga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page