(data stored in ACNUC7421 zone)

EMBL: CP001743.PE276

CP001743.PE276       Location/Qualifiers
FT   CDS_pept        complement(245036..245905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0280"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A3I510 Polysaccharide ABC
FT                   transporter permease; InterPro IPR000515; COGs: COG0395
FT                   ABC-type sugar transport system permease component; KEGG:
FT                   bsu:BSU07120 transmembrane lipoprotein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27058"
FT                   /protein_id="ADD27058.1"
FT                   /translation="MKKRSLSPGDRLFEWSIDLFLVGVLVVTLVPLWYVVMISLLPFGK
FT                   SPSLFLAPWDWSFEAYAQLVFQPTIWRAALNSLVLTLGGVAISLTLTVLAAYPLSRREL
FT                   PGRNLFVGLILFTFLFNAGLIPTFLVVKDLGLLNTYWSVLLNGAVSVYNLLVMKTFFQS
FT                   LPESLEEAARIDGANDWQVLWHVVLPLSRPILLTIGLFYGVANWNNFFEPILFLSDRSL
FT                   MPLPVVLRDILTGLNVAEYVEGTAAQAAPAEALKMAAVVLITLPMLLVYPWIQRYFTKG
FT                   VLIGSVKE"
     ttgaaaaagc gcagcctatc tcccggcgac cgcctctttg agtggagcat cgacctgttc        60
     ctggtggggg tgctggtggt caccctggtg cccctgtggt acgtggtgat gatctcgctg       120
     ctgccctttg gcaaaagccc cagtctgttc ctggccccct gggactggtc ttttgaagcc       180
     tacgcccagc tcgttttcca gcccaccatc tggcgggccg cgctcaacag cctggtgctc       240
     accctgggcg gtgtggccat cagcctgacc cttaccgtgc tggccgccta ccctctttca       300
     cgccgcgaac tgcccggcag gaacctgttt gtgggcctga ttctcttcac ctttttgttc       360
     aacgccggcc tgattcccac cttcctggtg gtcaaggatc tgggcctgct caacacctac       420
     tggtcggtgc tgctcaacgg ggcggtgagc gtctacaacc ttttggtgat gaaaaccttc       480
     tttcagagcc tgcccgagag cctcgaggag gccgcccgca tagatggggc caacgactgg       540
     caggtgctgt ggcacgtggt gctgcccctg tcccggccca tcctcctgac cattgggctg       600
     ttctacggcg tggctaactg gaacaacttc ttcgagccca tcctctttct ttccgaccgc       660
     agcctgatgc ctttaccggt ggtgctgcgg gacatcctga ccggcctcaa cgtggccgag       720
     tacgtggagg gcacggcggc ccaggctgcg ccggcggagg ctctgaagat ggcggcggtt       780
     gtccttatca cgctaccgat gcttctggta tacccctgga tccagcgtta tttcaccaag       840
     ggtgtgctga tcggcagcgt gaaggaatag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page