(data stored in ACNUC7421 zone)

EMBL: CP001743.PE277

CP001743.PE277       Location/Qualifiers
FT   CDS_pept        complement(245916..246863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0281"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: P39128 Protein lplB;
FT                   InterPro IPR000515; COGs: COG4209 ABC-type polysaccharide
FT                   transport system permease component; KEGG: bha:BH1065
FT                   hypothetical protein; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27059"
FT                   /protein_id="ADD27059.1"
FT                   /translation="MNPATAKSLAGHNGPATLVRRIWRYRLLYLMLLPGLLYFLVFRYW
FT                   PLWNAQIAFKDFQPTLGVWSSPWVGLQHFQDFFSSYYFGQLLANTLVISLAKIALGIPP
FT                   AILLAIALHETSRRFLARVVQTMSYLPHFLSWVIVYGILLAMLSPSEGLLNHGLRALGL
FT                   EPIPFLTSTATFQPVVVLSEVWKETGWSAILFLAALLSINPALYEAAAIDGASRWQQVR
FT                   HISLPGLMDVLVLVVLLKIGSILDAGFHQIFVLYSLPVYSVGDIIDTWVYRQGIQNFQF
FT                   SLATAVGLFKGLIGLVLIVVANRLARRFTGSSLY"
     atgaaccccg caaccgcaaa aagcctggct ggccacaacg ggcctgcaac cctcgtccgc        60
     cggatctggc gctaccggct gctttacctg atgctgctgc ccggcctgct ctactttctg       120
     gtttttcgct actggccctt gtggaacgcc cagatcgcct ttaaggactt ccagcccacg       180
     ctgggggtct ggagcagccc gtgggtgggc ctgcagcact ttcaggactt cttcagctct       240
     tactactttg gtcagctttt agccaacacc ctcgtgatca gcctggccaa gatcgcgctg       300
     ggtattcccc ccgccatcct actggcaatt gccctgcacg aaaccagccg gcgctttctg       360
     gcccgggtgg tgcagaccat gagctaccta ccgcactttt tgtcgtgggt catcgtctac       420
     ggcattctgc tggccatgct ctcccccagc gagggcctgc tgaaccacgg tttgcgggcg       480
     ctgggcctcg agcccatccc cttcctcacc tccaccgcca ccttccagcc ggtggtggtg       540
     ctctcggagg tctggaaaga gaccggctgg agcgcgattc tatttctggc cgccctgctt       600
     tccatcaacc cggccctcta cgaagccgcc gccatcgacg gagcctcgcg ctggcaacag       660
     gtgcgccata tctccctgcc ggggctgatg gatgtactgg tgctggtggt gctgctcaag       720
     atcggaagca tcctggacgc gggctttcac caaatctttg tcctgtactc gctgccggtc       780
     tacagcgtgg gggacatcat cgacacctgg gtgtaccggc agggcattca aaactttcag       840
     ttcagcctgg ctacagcggt gggcctgttc aagggcctga tcggcctggt cttgatcgtg       900
     gtggcgaacc gcctggcccg gcgctttacc ggcagcagcc tgtactag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page