(data stored in ACNUC7421 zone)

EMBL: CP001743.PE278

CP001743.PE278       Location/Qualifiers
FT   CDS_pept        complement(246860..247888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0282"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; InterPro IPR000843:IPR001761;
FT                   KEGG: vei:Veis_0948 periplasmic binding protein/LacI
FT                   transcriptional regulator; COGs: COG1609 Transcriptional
FT                   regulators; SPTR: A7CQD4 Periplasmic binding protein/LacI
FT                   transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, lacI family; Periplasmic binding proteins and
FT                   sugar binding domain of the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27060"
FT                   /protein_id="ADD27060.1"
FT                   /translation="MSSEKVTLAHVARLAGVSIITVSRVLNNKGRFSEATRARVLQAAN
FT                   QLGYVANTAARSLRGHPTQILGMVIPELVSPYFAELARAAADAASQMGYDLAVFTTSRD
FT                   PERERERVGALLGGLADGLIIVVPIGSAGFLASLERSRAPVVLVNHFGAPTHLPVVRAD
FT                   SFEGSLAAVRHLLALGHRRIGFITGAAHSSQATERLRAYRECMLAAGLWDERLVRPGDF
FT                   TQQRGVEAGHELLSLEEPPTAIFAASDLTAFGVIAAAQARGLQVPQDLSVVGFDDIPTA
FT                   AHSHPSLTTVAHPIQAMGQAMVDLIIKAKAGEQVRDVLVEFPSELIVRESSAPPRIPGE
FT                   KV"
     atgtctagcg aaaaggttac cttagctcat gtggcccgcc tcgccggggt ctccatcatc        60
     accgtctcca gggtgctcaa caacaaaggg cgcttctcgg aggccacccg ggcccgggtg       120
     ctccaggccg ccaaccagct cggctacgta gccaatacgg cggcgcgtag cctgcgcggg       180
     caccccaccc agattctggg gatggtcatt cccgagctgg tcagcccgta ttttgccgag       240
     ttggcgcggg ccgcggccga tgcggccagc cagatgggct acgacctggc ggtgtttacc       300
     acctcacgcg acccggagcg ggagcgcgag cgggtggggg ccctgctcgg tgggctggcc       360
     gacggactga tcatagtggt gccgattggg tcggcgggct ttttagccag cctcgagcgc       420
     agccgcgccc cggtggtgct ggtcaaccat ttcggcgcac caacccacct cccggtggtg       480
     cgggccgaca gcttcgaggg ttccctggcc gctgtgcggc acctgctggc cctgggccac       540
     cggcgcatcg gttttatcac cggagcggcc cactccagcc aggccaccga gcgcctgcgc       600
     gcctaccggg agtgcatgct ggcggcgggg ctgtgggatg agcggctggt gcggcccggg       660
     gacttcaccc agcagcgggg ggtggaggcc ggccatgagc ttttgagcct cgaggagccc       720
     cccaccgcca tcttcgcggc cagcgacctc accgcctttg gggttatcgc cgcggcccag       780
     gcccggggtt tgcaggtgcc gcaagacctc tcggtggtgg gcttcgacga catccccacc       840
     gcggcccact cccaccccag cctgaccacc gtagcgcatc ccattcaagc catgggccag       900
     gccatggtgg atctgatcat caaggccaag gccggcgagc aggtgcgcga cgtgctggtg       960
     gagtttccca gcgagctgat cgttcgggaa tcgagcgcac ccccccgaat ccccggagaa      1020
     aaagtatga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page