(data stored in ACNUC7421 zone)

EMBL: CP001743.PE281

CP001743.PE281       Location/Qualifiers
FT   CDS_pept        250473..251456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A6CVW5 ABC-type sugar
FT                   transport system, permease component; InterPro IPR000515;
FT                   COGs: COG1175 ABC-type sugar transport systems permease
FT                   components; KEGG: hch:HCH_06909 ABC-type sugar transport
FT                   system, permease components; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27063"
FT                   /protein_id="ADD27063.1"
FT                   /translation="MRKSVRIPTSGHAGPSLAMRWSSFQRRYAPYIFVSPFFILFLIFG
FT                   LYPTLFSLYMSFQAWTPSDGWGRWKYVGLENYTFTLTDPMFWRSMWNTVWLGVFSGIPQ
FT                   HLIAIPLAFVIHMVLSRFKTFVTAVYFLPYITSSVAIALIFNTLFATNNGVINLVIAHL
FT                   NTWPLLGALLPDQNINWFTSANIKYALALVVIWQFTGWNTLLYLSAIQAIPKDLYEAAA
FT                   VDGATRVQQFRYITLPLLRPMMFFAVSLTIIGNMQLFEQPFVLLNGGASAATPGGQTAT
FT                   MYMYRTAFEWLEMGTAASIAWILFVFIGILTYLNNLIFGRAARGGD"
     gtgcgaaagt ctgttcgcat cccaacctcc ggccatgccg gccccagcct ggctatgcgc        60
     tggagcagct tccagcgccg ctatgcgccc tacatttttg tcagtccctt tttcatcctt       120
     ttcctgattt ttggcctgta ccccacgctg ttttctctgt acatgtcctt tcaggcctgg       180
     acgcccagcg acgggtgggg ccggtggaag tacgtgggcc tcgagaacta caccttcacc       240
     ctgaccgacc ccatgttctg gcgctccatg tggaacaccg tctggctggg ggtgttctcg       300
     ggtatcccac agcacctgat tgccattccg ctggcctttg tgattcacat ggtgctcagc       360
     cgcttcaaga cctttgtcac ggcggtttac ttcctcccct acatcacttc ttcggtggcc       420
     attgccctca tcttcaacac cctttttgcc accaacaacg gtgttatcaa cctggtgatc       480
     gcccacctca acacctggcc tctgctgggt gcgctgctgc ccgaccagaa catcaactgg       540
     ttcaccagcg ccaacatcaa gtacgccctt gcactggtgg taatctggca gtttaccggc       600
     tggaacactc tgctctacct ctcggccatc caggccattc ccaaagacct ttacgaagcc       660
     gctgcggtgg atggggccac ccgcgttcag cagttccgct acatcaccct gccccttctg       720
     cggcccatga tgttttttgc tgttagcctc accatcattg gcaacatgca gctttttgag       780
     cagccctttg tgttgctgaa cgggggcgcc agcgcggcca caccgggggg acagaccgcc       840
     accatgtaca tgtaccgcac ggcttttgag tggcttgaga tgggcacggc ggcttccatc       900
     gcctggatac tcttcgtttt tatcggcata ctcacctacc tcaacaacct gatttttggg       960
     cgtgcagctc gaggaggcga ttag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page