(data stored in ACNUC7421 zone)

EMBL: CP001743.PE289

CP001743.PE289       Location/Qualifiers
FT   CDS_pept        261403..262368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0293"
FT                   /product="Dipeptidylaminopeptidase/acylaminoacyl-peptidase"
FT                   /note="SPTR: A5P745 Prolyl oligopeptidase family protein;
FT                   InterPro IPR002471; COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; KEGG: mxa:MXAN_5299
FT                   peptidase, S9C (acylaminoacyl-peptidase) subfamily; PFAM:
FT                   Dienelactone hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27071"
FT                   /protein_id="ADD27071.1"
FT                   /translation="MSHTLRFGTTLLAVLLGTALAQGGLEAHPMSIEALRQGSYPGSAI
FT                   TLEQTLAPGANYRRYIASYRSEGLKIYGLLTVPNGARPRAGWPAIVFVHGYIPPAQYRT
FT                   TERYGAYVDALARAGYIVFKIDLRGHGNSEGTASGAYWSPDYTIDTLNAFASLRRFPQA
FT                   NPERIGIWGHSMGGYLALRAMVVEPRIRVGVIWAGVVGTYEDLLYRWRRSPPAQLPPGA
FT                   LRRRELFLARYGSPESNPGFWASITAHNYLERVGPIQLHHGLADTVVPVSFSQRLAQYL
FT                   RAAGRPYELFTYPGNDHNLSQSFSLAMRRSVAYFDRYLKR"
     atgagccaca ccctgcgctt tggaacaacg ctgctggcgg tcttgctggg tacggcgctg        60
     gcccaggggg ggctcgaggc ccatcccatg tccatcgagg ccctgcgcca gggcagctat       120
     ccgggcagcg ccatcaccct cgagcaaacc ctggcccccg gcgccaacta ccgccgctat       180
     attgcttcat accgttcgga ggggctgaaa atctacggcc tgctcaccgt tcccaacggc       240
     gcacgccccc gggcgggctg gccggccatc gtcttcgtgc atggctacat cccaccggcc       300
     cagtaccgca ccaccgagcg ctatggggcc tatgtggacg cgctggcccg ggccggctat       360
     atcgtgttca agattgacct gcgcgggcac ggcaactccg agggcaccgc cagcggggcc       420
     tactggtcgc cggactacac cattgatacc ctcaacgcct ttgcctcgct gcgccggttt       480
     ccccaggcca accccgagcg catcggcatc tggggccact ccatgggggg ctacctggcc       540
     ctgcgggcca tggtggtgga gccgcgcatc cgggtggggg tgatctgggc gggggtggtg       600
     ggcacctacg aagacctgct ctaccgctgg cggcgcagcc ccccggccca gcttccgccg       660
     ggcgccttgc ggcggcgtga gctgtttctg gcccgctacg gctcgcccga gagcaacccc       720
     ggtttctggg cctccatcac cgcccacaac tacctcgagc gggtcgggcc catccagctt       780
     caccacggcc tggccgacac ggtggtgccg gtgagctttt cccagcgcct ggcccagtac       840
     ctgcgggccg ccgggcggcc ctacgagctt tttacctatc ctggcaacga ccacaacctg       900
     agccagagct ttagcctggc catgcggcgc tcggtggcct atttcgaccg ttacctgaag       960
     cgctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page