(data stored in ACNUC7421 zone)

EMBL: CP001743.PE294

CP001743.PE294       Location/Qualifiers
FT   CDS_pept        266025..266654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_0396 carboxynorspermidine
FT                   decarboxylase; SPTR: Q46BC2 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27076"
FT                   /protein_id="ADD27076.1"
FT                   /translation="MRREMLWVGITGLVLVGVVLTQGLWGYGGPMHGYGYGPGMMGGGM
FT                   GMMSVYPAQAQPIPPAEARARLESFAKRFGSEARLKDFMSFSENYYAQVVDAKGNGLVE
FT                   ILADRYTGSVYLEPGPNMMWNTRWGMGMMQVQPSVAVRYDKAAAQKLAEQFLKGYLPGA
FT                   RVMEGQAFSGYYTFDFGRKEIEGMMSVSAYTGEVWIHTWHGVFLGE"
     atgcgacgcg agatgctctg ggtgggaatc acaggcctgg ttttggtagg cgttgtcctc        60
     acccagggtc tgtggggcta cgggggcccc atgcacggct acggatacgg ccctggaatg       120
     atgggtggag gaatgggcat gatgagcgtt taccccgccc aagcccagcc catcccccct       180
     gccgaagcca gggctcgcct cgagtccttc gctaaacgct tcggttccga ggccaggctc       240
     aaggacttca tgagcttcag cgaaaactac tacgcccagg tagttgatgc caaggggaac       300
     gggctggtgg agatcctggc cgatcgctac accggtagcg tctacctcga gcccggcccc       360
     aacatgatgt ggaacacccg ctggggcatg ggcatgatgc aagtccagcc ttctgtagct       420
     gtgcgctacg acaaggctgc cgcacagaag ctggccgaac agtttctcaa gggctacctg       480
     ccgggagcca gggtcatgga gggccaggct ttcagcggtt actacacctt tgactttggc       540
     cgcaaggaga tcgagggcat gatgtcggtg agcgcctata ccggtgaggt ctggatccac       600
     acctggcatg gggtcttctt gggcgagtag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page