(data stored in ACNUC7421 zone)

EMBL: CP001743.PE296

CP001743.PE296       Location/Qualifiers
FT   CDS_pept        266953..267144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27078"
FT                   /protein_id="ADD27078.1"
FT                   /translation="MAERFGMYVEYGAYPHLKLPVDTEIAAVQDWTNATLVFLRPSYES
FT                   KEELIAAIPVLVICKPQG"
     gtggccgagc gcttcggcat gtacgtcgag tacggggcct atccccacct caagctgccc        60
     gtcgacaccg aaatcgccgc tgtgcaagac tggaccaacg ccacgttggt cttcctgcgg       120
     ccttcttacg agagcaaaga agagttgatc gcggcaattc cggtgttggt gatttgtaag       180
     ccacagggct aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page