(data stored in ACNUC7421 zone)

EMBL: CP001743.PE297

CP001743.PE297       Location/Qualifiers
FT   CDS_pept        267211..269631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0301"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase;
FT                   InterProIPR000579:IPR001757:IPR001756:IPR008250:IPR
FT                   005834:IPR001412:IPR006121:IPR006403:IPR006416; KEGG:
FT                   xau:Xaut_4847 copper-translocating P-type ATPase; COGs:
FT                   COG2217 Cation transport ATPase; SPTR: A3TK31 Putative
FT                   cation-transporting ATPase; PFAM: E1-E2 ATPase; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: heavy metal
FT                   translocating P-type ATPase; heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC;
FT                   copper-(or silver)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27079"
FT                   /protein_id="ADD27079.1"
FT                   /translation="MSKADHDPHLPEALLELSLKNCHDASEQADLERHLARLPGVSSVH
FT                   LDRTRALAHISFDPGQISAQDLRERLERGGYSCACQECEASVCQPGHPRVGSDDQPHTH
FT                   PHHHPAHEVVTEPHAHRTAPTKAHDHAAMPPVHDAHAGHGAAMVADMLRRFVVSLLLTL
FT                   PIVIFSPIGGSLGFPEMPPFGISMGLWGFLLSTPVVWWGGWPFIRAAWRALRRGEANMM
FT                   TLIATGILVSWTFSVAATFLFEGEVFYEAAAMLTTFSLAGHWMEMRSRFATGRAVEALL
FT                   KLAPATARVLRGGQEVEIPLEQVVVGDVIVVKPGDRVPVDGVVLSGQSYVDESMISGEP
FT                   IPVAKAPGSKVIGGSVNQTGAFTFEATAVGADTALSRIVQMVQNAQASKAPAQRLADIA
FT                   GKYLVFIALGSGLLTFVFWYFFAAQGLVFALTAGVSAIVIACPDALALATPTAITVGVG
FT                   VAAREGVLFKNATALEATAGVDTVIFDKTGTLTEGKPALTDLITAGGMAEQELLRLAAS
FT                   ADLPSQHPLAEAIVRAAREQGLTLNQPEEFDSVPGHGVVAKVHGQRVLIGNKKLMEREK
FT                   VAVEALEERAAQLSADGKTAMFVAVDGRAAGVVAVADAVRESAKRAVGLLHALGIETVM
FT                   LTGDNRRTAEAVARQIGIDTVIAEVLPEDKAAKVKELQAQGRKVAMVGDGVNDAPALAQ
FT                   ADVGIAIGAGTDVAVESAEVVLVKNDPADVAKAIQLARKVRGKIKQNLFWAAIYNVLAI
FT                   PIAAGVLYNSYGLLLRPEWAALLMSASTVIVTLNALLLGVRSRPRELTKGVGA"
     atgtcgaaag cagaccacga tccccacctg cccgaagcgt tactcgagct cagcctcaaa        60
     aactgccacg acgcttccga acaagccgac ctggaacgcc acctggcccg gctgcccggc       120
     gtcagcagcg tccacctcga ccgcacccgc gccctagcgc acatcagttt cgatcctgga       180
     caaatcagtg cccaggactt gcgcgagcgg ctcgagcggg gcggctatag ctgcgcctgc       240
     caggaatgtg aggcctcggt ctgccagccc ggccatccca gggtcggctc ggatgaccag       300
     ccacacacgc atccccatca ccacccagcc catgaggtcg taacagagcc ccacgcacac       360
     cgtactgctc cgaccaaagc ccacgaccac gcggccatgc cgccagtgca cgacgctcac       420
     gccgggcatg gggcggcgat ggtggctgac atgctgcggc gcttcgtggt ctcgctcttg       480
     ctgaccctgc ccatcgtgat cttttcaccc atcggcggat ccctgggttt ccctgagatg       540
     ccaccctttg gtatttcgat gggactgtgg ggtttcctgc tgagcacccc cgtggtgtgg       600
     tggggtggct ggcccttcat acgtgcggcc tggcgggcac tgcggcgcgg cgaggccaac       660
     atgatgaccc tcatcgccac gggcattctg gtctcctgga ctttctcggt ggcagccacc       720
     ttccttttcg agggcgaggt cttctacgag gccgccgcga tgctcaccac cttcagcctg       780
     gctgggcact ggatggagat gcgctcgcgc ttcgctaccg ggcgggcggt ggaggcgctg       840
     ctgaaactgg ccccggccac ggcccgggtt ctgcgggggg ggcaggaggt ggaaatcccg       900
     ctcgagcagg tggttgtagg ggacgtaatt gtggtcaaac cgggcgaccg ggttccggta       960
     gatggagtgg tgctctcagg tcagagctac gtcgatgagt ccatgatcag cggtgaaccc      1020
     atccccgtag ccaaggctcc cggctctaag gtgatcgggg ggagcgtcaa ccagaccggg      1080
     gctttcacct tcgaggccac ggcagtaggg gccgacacgg ccctctcgcg catcgtgcag      1140
     atggtgcaga acgcccaggc ctccaaggct ccggcccagc gcctggccga cattgccggg      1200
     aagtatttgg tgttcatcgc cctggggtca ggcctgctga ccttcgtgtt ctggtacttc      1260
     tttgccgcgc aggggctggt cttcgccctc accgcgggtg tctcggccat cgtaatcgcc      1320
     tgtcccgacg ccctggccct ggccaccccc accgccatca ccgtaggggt aggcgtggcc      1380
     gcccgggagg gcgtgctgtt caagaacgcg acggcgctgg aagccacggc gggcgtggac      1440
     acagtgatct tcgacaagac cggcaccctc accgagggca aaccggccct caccgacctg      1500
     atcactgctg ggggcatggc ggagcaggaa ctgctgcgcc tggcggcctc ggccgacctg      1560
     ccctcgcagc accccctggc cgaggccatc gtgcgggcgg cccgtgagca gggcctgacc      1620
     ctgaaccagc cggaggaatt cgactcggtg ccgggtcacg gggtggtggc gaaggtgcac      1680
     gggcagaggg tgctcatcgg caacaagaag ctgatggagc gggaaaaggt ggcagtggag      1740
     gcgctcgagg aacgcgcagc ccagctttct gctgatggca agacggctat gtttgtagcg      1800
     gtggatggcc gggctgctgg ggtggtggcg gtggccgacg ccgtgcgcga atcggccaag      1860
     cgagcggtcg ggttgctcca tgcgctgggt atcgagacgg tgatgctcac cggagacaac      1920
     cgccgcaccg ccgaggctgt ggctcgacag attggcatag atacggtgat cgccgaggtg      1980
     ctgccggagg acaaggccgc caaggtcaag gaattacagg cccaggggcg taaggtggcg      2040
     atggtcggcg acggggtgaa tgacgccccc gcactggccc aggccgacgt aggtatcgcc      2100
     atcggggcag gaacggatgt agcggtggag tccgccgagg tggtgctggt gaagaacgac      2160
     cccgccgacg tggccaaggc catccaactg gcccgcaagg tgcgcggcaa gatcaagcaa      2220
     aacctcttct gggcggccat ctacaacgtg ctcgccatcc ccatcgcggc aggagtgctc      2280
     tacaacagtt acggcctgct gctgcggccc gagtgggcgg cgctcttgat gagcgcctcg      2340
     acggtgatcg tgacgctgaa cgccctgctg ctgggggtga gatcccgacc tcgggagctt      2400
     acaaagggag ttggtgcata a                                                2421
//

If you have problems or comments...

PBIL Back to PBIL home page