(data stored in ACNUC7421 zone)

EMBL: CP001743.PE3

CP001743.PE3         Location/Qualifiers
FT   CDS_pept        3114..4388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0003"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="TIGRFAM: enolase; PRIAM: Phosphopyruvate hydratase;
FT                   PFAM: enolase; SPTR: Q5SME1 Enolase; KEGG: aba:Acid345_1070
FT                   enolase; COGs: COG0148 Enolase; InterPro IPR000941; PFAM:
FT                   Enolase, N-terminal domain; Enolase, C-terminal TIM barrel
FT                   domain; TIGRFAM: phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26785"
FT                   /protein_id="ADD26785.1"
FT                   /translation="MTTIVEIKGREVLDSRGNPTVEAEVVLESGARGRAMVPSGASTGA
FT                   HEAVELRDGGPRFGGKGVLRAVAAINERIADEVIGLDALNQEAVDKTMLELDGTPNKGN
FT                   LGANAILAVSLATAHAAASGLGLPLYRYLGGVQGVTLPVPLMNVINGGKHADNNVDFQE
FT                   FMLVPGGLPTFSEALRAGVETFHALKSVLKAKGYNTNVGDEGGFAPDLKSNEEAVEVLL
FT                   TAIEKAGYKPGQEIAIALDPASSEFYQEGRYVLEADGKSLSGPEMVAYWENWVNQYPIV
FT                   SIEDGLAEDDWETWKLLTERLGRRIQLVGDDLFVTNPAILKRGIELGVGNSILVKVNQI
FT                   GTLSETLEAIRLAHRSGYTTILSHRSGETEDNTIADIAVAVNAGQIKTGSASRSDRLAK
FT                   YNQLLRIEEELGTGARFLGFGAFKK"
     atgaccacaa tcgttgagat caaaggacgg gaagtactcg actcgcgcgg caaccccacc        60
     gtcgaggccg aggtggtgct cgagtcgggg gcccgtgggc gggccatggt gccttcgggt       120
     gcctctaccg gggcccatga agcggtggag ctacgggatg gcgggccccg cttcgggggc       180
     aagggggtgc tgcgggcggt ggcggccatc aacgagcgca tcgccgacga ggtgatcggg       240
     ctggacgcgc ttaatcagga ggccgtggat aaaaccatgc tcgagctcga cggcaccccc       300
     aacaaaggca acctgggggc caatgccatt ctggcggtct cgctggccac ggcccatgcg       360
     gcggccagcg ggctgggctt gccgctctac cgctacctgg ggggggtgca gggggtgacc       420
     ctgccggtgc ccttgatgaa cgtgatcaac gggggcaagc acgccgataa caacgtggac       480
     ttccaggagt tcatgctggt gcccggtggg ctgcccacct tctcggaggc cctgcgggcc       540
     ggggtcgaga ctttccacgc cctgaaatcg gtcttgaaag ccaaaggcta caataccaat       600
     gtgggggacg agggggggtt cgcccccgat ctcaagtcca atgaggaggc ggtggaggtg       660
     ctgcttacgg ccatcgagaa ggccggctac aagcctggcc aggagatcgc catcgccctc       720
     gacccggcca gctcggagtt ttaccaggag ggccgctacg tgctcgaggc cgacggcaag       780
     tcgctctccg gcccggagat ggtggcctac tgggaaaact gggtgaacca gtaccccatc       840
     gtctccatcg aggacgggct ggccgaggat gactgggaga cctggaaact cctgaccgag       900
     cggctgggcc ggcgcatcca gctcgtgggc gacgaccttt ttgtaaccaa cccagccatc       960
     ctgaagcgcg gcatcgagct gggggtggga aactccattc tggtcaaggt caaccagatc      1020
     ggcaccctct ccgaaaccct ggaggccatc cggctggccc accgctccgg ctacaccacc      1080
     atcctctcgc accgctcggg tgagaccgag gataacacca ttgccgacat cgccgtggcg      1140
     gttaatgccg gccagatcaa gaccggctcg gccagccgct cggatcgcct ggccaagtac      1200
     aaccagcttt tgcgcatcga agaggagctg ggcacggggg cgcgattcct gggctttggg      1260
     gccttcaaaa aataa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page