(data stored in ACNUC7421 zone)

EMBL: CP001743.PE300

CP001743.PE300       Location/Qualifiers
FT   CDS_pept        271513..273012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0304"
FT                   /product="multicopper oxidase type 3"
FT                   /note="PFAM: multicopper oxidase type 3; multicopper
FT                   oxidase type 1; multicopper oxidase type 2; SPTR: A0YQP5
FT                   Laccase;
FT                   InterProIPR001117:IPR011707:IPR011706:IPR002355:IPR 006311;
FT                   COGs: COG2132 Putative multicopper oxidase; KEGG:
FT                   multicopper oxidase type 2; PFAM: Multicopper oxidase;
FT                   Multicopper oxidase; Multicopper oxidase; TIGRFAM: Tat
FT                   (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27082"
FT                   /protein_id="ADD27082.1"
FT                   /translation="MKLTRRNTIKLLGAGLGSALVGAHWPGLAQGTLAFPEPKLLPLRR
FT                   LESGLVEASLAARESNLSIGGKPVTLLTYGGMPGPTLRLREGETVRLQFTNHLTQVTNL
FT                   HLHGLHVSPEVDDPLAQIQPGQSRMYEFTVPKGSAGTYWYHPHIHGRVAEQLYAGLLGL
FT                   IVVEGPVDAIPELREAEEHVLVLKDFAFSGSRIAPFTPMDWMNGKEGDLLTVNAVIRPT
FT                   LRAQRGTLRLRILNASNARYYRLALENHPLYLIATDGGFVEKPVELRELLLAPGERAEV
FT                   LIRLTQAGSFRLQALPYDRGAMMMHGGGMGMMNHQGMGGMSHGGEQSTLAMQGMMMGMG
FT                   PSRLETLLTIVAPPNPKPLPLPTSLATVERLDLTKVAATRRFELGERMMQAEFFINGRM
FT                   FDPGRVDVRARRGTLEVWELINKTDMDHPFHLHTYPFQVLSINGRPQPYRAWKDTVNLK
FT                   KNDVVRIAIPFRDFIGTTVYHCHIVEHEDRGMMGVLQVEAE"
     atgaagctaa cccgacgcaa caccatcaaa ctactgggcg ctggcctggg cagtgccctg        60
     gtaggagccc attggcccgg cctggcccag ggaaccctgg ccttccccga gcccaagttg       120
     cttccactca ggcgactcga atcaggcttg gttgaagcca gccttgccgc cagggagagc       180
     aatctaagca taggcggcaa gcccgtaacc ctgctgactt acgggggcat gccagggcca       240
     accctacgac tccgggaagg ggagacggtg cggctgcagt tcactaacca cctgacccag       300
     gtaaccaacc tacacctgca cggactgcac gtatcgcccg aggtagacga tcccctggcc       360
     cagattcagc ctggtcagag ccgtatgtac gagttcacgg ttcccaaagg ttcggcgggc       420
     acctactggt accatcccca tatccacgga agggtggccg aacagctata tgcggggttg       480
     ctcggtctca tcgtggtaga gggccctgtg gatgccatac ccgaactaag agaagctgaa       540
     gagcacgtac tggtgctaaa ggacttcgct ttttctggca gccgcattgc ccctttcacc       600
     ccgatggact ggatgaacgg caaggagggg gacctactga ccgtcaatgc cgtaattcgc       660
     ccgactttgc gggcccagcg gggaactttg cgattgcgca tcttgaatgc cagcaacgcc       720
     cgctactatc ggctggccct ggaaaaccat cccctttacc tgattgccac cgatggcggt       780
     tttgtcgaga agccggtgga gcttcgcgag ctcctgctgg ccccgggtga gcgggccgaa       840
     gtgctaatac gcctaaccca ggcaggcagc ttccgcctac aggccttgcc ctacgatcgg       900
     ggtgcgatga tgatgcacgg tggcgggatg gggatgatga atcatcaggg catgggtgga       960
     atgagccatg gaggggagca aagtacgctg gcaatgcagg gtatgatgat ggggatgggg      1020
     ccaagccgcc tcgagaccct tctaaccatc gtcgcaccgc ccaaccccaa gccgctgccc      1080
     ctacctactt ccctggccac ggtcgagcgg ctcgacctta ccaaggtggc cgctacccgc      1140
     cgctttgagc tgggtgaacg tatgatgcag gctgaatttt tcatcaacgg tcggatgttt      1200
     gatccaggcc gggtagatgt gcgggctcga cggggcaccc tcgaggtttg ggagctgatt      1260
     aataaaaccg acatggatca ccctttccac ctacacacct acccattcca ggtgctttcg      1320
     atcaacggta ggccccagcc ttaccgggcc tggaaggaca ccgtcaacct aaagaaaaat      1380
     gacgtggtgc gcattgccat cccctttcgc gactttattg gcaccacggt gtaccactgc      1440
     catatcgtcg agcacgaaga tcgtggcatg atgggggtct tgcaggtaga agccgaataa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page