(data stored in ACNUC7421 zone)

EMBL: CP001743.PE305

CP001743.PE305       Location/Qualifiers
FT   CDS_pept        277806..279386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27087"
FT                   /protein_id="ADD27087.1"
FT                   /translation="MRRTKMLLLLGGLGLLLGACGGEYTDNPTPDSSNGPFLAEPLTQH
FT                   PTNLPLTLLNRYLVVSEEDGRLRASYSGLRYWPRQADKNRNPNNPSQPSGPRFTQYAGW
FT                   DILDVPGSSVSRADWLRLSLTRPATVVVAWEHSALWLAGWQKGETTAADGKKFNTYTRT
FT                   FRAGEITLGSPEGKGEYWVLLAEGNGQPSAEPPLPSGITERPVPNTTCPSWLENLWQAK
FT                   GPDGRNYPSWHPQIDPVYWCYYRHDHNADPGLIGYQAPFLYTAQYTNNQPERAEGFKGF
FT                   AIRDGEIGWYFNIHSETSTDQRVCARFHTVVVVATRWRTGEKLAELNYKGDFGASRQNQ
FT                   GDNPFFANTCTDPRTGQQVTQEQIGQQLQSTTRASKRIRIAANNSGYEQWDGGLVKALG
FT                   MEFSGPGMGIDIQNPATACNALHCTDLVTNNSSSTRRTLQIMNLRLRYKPELDPDGDGY
FT                   FETNLYGDGPYIAGDRNSGIGPLKQYIKPGTDLRLDGFFTTEDAWRGLYVRGGSTQDVE
FT                   LEGALGTVN"
     atgcgacgaa ccaaaatgct tttgctgctg ggcggcctgg gcctgctgct gggggcctgc        60
     ggcggggagt acaccgacaa ccccaccccc gatagctcca acggcccctt cctggccgag       120
     cccctcaccc agcaccccac caacctgccc ctgaccctgc tcaaccgcta cctggtggtg       180
     agcgaagagg acgggcgctt gcgggccagc tacagcgggc tgcgctactg gccgcgccag       240
     gccgacaaaa accgcaaccc caacaacccc agccagccct cggggccgcg ctttacccag       300
     tacgccggct gggacatcct ggacgtgccc ggctcgagcg tctcgcgggc cgactggctg       360
     cgcctgagcc tgacccgccc cgccacggtg gtggtggcct gggaacactc ggcgctgtgg       420
     ctggcgggtt ggcagaaagg ggagaccacc gctgccgatg gcaagaagtt caacacctat       480
     acccgtacct tccgggctgg tgagatcacc ctgggctccc ctgagggcaa gggtgagtac       540
     tgggtgctgc tggccgaagg caacgggcaa ccttcggcag aaccccccct gcccagcggc       600
     atcaccgaac ggccggtgcc caacaccacc tgcccctcct ggctcgaaaa cctctggcag       660
     gccaaagggc cggatgggcg caactaccca agctggcacc cccagatcga cccggtttac       720
     tggtgttact accgccacga ccacaacgcc gaccccggcc tgatcggcta ccaggccccc       780
     ttcctctaca ccgcacagta caccaacaac cagcctgagc gggccgaggg ctttaagggc       840
     tttgccatcc gcgacggcga gatcggctgg tatttcaaca tccactccga gaccagcacc       900
     gaccagcggg tctgcgcccg cttccacacc gtggtggtgg tggctacgcg ctggcgcacc       960
     ggcgagaagc tggccgagct caactacaaa ggcgactttg gggcctcgag gcagaaccag      1020
     ggcgacaatc ccttcttcgc caacacctgc accgaccccc gcaccggcca gcaggtcacc      1080
     caggagcaga tcggccagca attgcaaagc accacccggg cctccaagcg catccgcatc      1140
     gccgccaaca actcgggcta cgaacagtgg gatgggggcc tggtcaaggc cttaggcatg      1200
     gagtttagcg gccccggcat gggcattgac atccagaacc cggccaccgc ctgcaacgcg      1260
     cttcactgca ccgatctggt caccaacaac tcctccagca cccgccgcac gctgcaaatc      1320
     atgaacctgc ggctgcgcta caagcccgaa ctcgaccccg acggcgacgg ctacttcgag      1380
     accaacctgt acggcgatgg gccttacatc gccggcgacc gcaactcggg gattggcccc      1440
     cttaagcagt acatcaaacc cgggaccgac ctgcgcctgg acggcttctt caccaccgag      1500
     gatgcctggc gcgggctgta tgtgcgtggt ggcagtaccc aggatgtcga gctcgagggc      1560
     gcgctgggca cggtgaacta a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page