(data stored in ACNUC7421 zone)

EMBL: CP001743.PE308

CP001743.PE308       Location/Qualifiers
FT   CDS_pept        280656..281204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0312"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; InterPro IPR001647;
FT                   KEGG: smt:Smal_0425 transcriptional regulator, TetR family;
FT                   SPTR: A3X7M9 Transcriptional regulator, TetR family
FT                   protein; PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27090"
FT                   /protein_id="ADD27090.1"
FT                   /translation="MDTRQALLQSARKAFAERGYAATSLEDLARTLGLTKAAVYHHFAS
FT                   KRELLEALLQEGFAETQRALAQPGTLHQRLMALALAYRGQVEPLTALMTAYSSRRGGDL
FT                   EAVKLAREAMQRGIEQLAGLLEQVAPGHGRALAVIFASIVHGAYMTAQHMPGYSAEALL
FT                   QEGVALFVRGLPDKAGEST"
     atggacaccc gccaagccct cttgcagagc gcccgtaaag cgtttgcaga gcgggggtat        60
     gccgcaacca gcctggaaga cctggcccgc accctgggcc tgaccaaggc cgcggtgtac       120
     caccacttcg cttccaagcg cgagctgctg gaggctttgt tgcaggaggg ctttgccgag       180
     acccagcggg ccctggccca gccgggcacg ctgcaccagc gcctgatggc cctggccctg       240
     gcctaccggg ggcaggtgga gcccctgacc gccctgatga ccgcctactc gagccgccgg       300
     ggcggcgacc tcgaggcggt caagctggcc cgcgaggcca tgcagcgtgg catcgaacaa       360
     ctggccgggc tgctggagca ggttgcgccg gggcatggcc gggccctggc ggttatcttt       420
     gcctcgattg tgcacggggc ctacatgacc gcccagcaca tgcccggcta ctcggccgag       480
     gcgcttttgc aggaaggggt ggccctgttt gtgcggggct taccggacaa ggccggggag       540
     tccacctaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page