(data stored in ACNUC7421 zone)

EMBL: CP001743.PE31

CP001743.PE31        Location/Qualifiers
FT   CDS_pept        27163..28434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0032"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein;
FT                   InterProIPR004358:IPR003594:IPR003661:IPR003660:IPR 005467;
FT                   KEGG: psb:Psyr_2867 sensor histidine kinase; COGs: COG5002
FT                   Signal transduction histidine kinase; SPTR: A7CBG9 Sensor
FT                   protein; PFAM: His Kinase A (phosphoacceptor) domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26813"
FT                   /protein_id="ADD26813.1"
FT                   /translation="MRFFNRIEVRLSLLMALVVVATSLLTVGLNTYQRERTFRELPAEV
FT                   RDILRRSDSRLPALGFPSELRDVLLSGQEIRVRLEPNPDPENPNPVFVLSLPDGSGTEI
FT                   RVQPPPRLRRPNLETRLQQNLLIASLAATGLGVLLALIFARRIARPIEAISDAAGRLAQ
FT                   GDLKARVGPQPGEDEVARLARNFDQMAEALERLEAERRAMIADIAHELRTPLTVMQGRL
FT                   EAIQDGVMPLEMSEVDRLHQQARLLSRLVEDLRTLSLADAGRLNLTLQPLNLAELADRM
FT                   ADTFQAALEAKRITLERRLPEGPVLVRADSDRLAQVIGNLLSNALGHTPAGGWIGLEVA
FT                   AEAAQARLRVLDSGPGIPAEALNKVFDRFYRAEASRSRATGGSGLGLSIVKALVELHKG
FT                   TVTARNRPEGGAVFEVRLPLHQAG"
     atgcgctttt tcaatcgtat cgaggttcga ctaagcctgc tgatggcgct ggtggtggtg        60
     gcgaccagcc tgctcacggt gggtctcaac acctaccagc gcgagcgcac cttccgggag       120
     ctgcccgccg aggtgcgcga tatcctgcgg cgcagcgata gccgcctgcc ggcgctgggt       180
     ttcccttcgg agctgcgcga tgtgctgctt tccggccagg agattcgcgt gcggctcgag       240
     cccaaccccg accctgagaa ccccaacccg gtctttgtgc tgagcctgcc cgatggttcg       300
     ggcaccgaga ttcgggtgca gccgccgccc cgcctgcggc ggcccaacct ggagacccgg       360
     ttgcagcaga acctgctgat tgcgagcctg gccgcgaccg gcctgggggt gctgctggcg       420
     ctgatctttg cccggcggat tgcgcggccc atcgaggcca tttccgatgc cgcaggccgc       480
     ctggcccagg gcgacctcaa ggcccgggtg ggcccccagc cgggcgagga cgaggtggcc       540
     cggctggccc gcaacttcga ccagatggcc gaggctttgg agcggctcga ggccgagcgc       600
     cgggccatga ttgccgatat tgcccacgag ctgcgcaccc ccctcacggt gatgcagggc       660
     cgcctcgagg ccatccagga tggggtcatg cccctggaga tgagcgaggt agaccggctg       720
     caccagcagg cccggctgct ctcgcgcctg gttgaagacc tgcgcaccct ttcgctggcc       780
     gatgcggggc ggctcaacct gaccttgcag cccctcaacc tggctgagct ggccgaccgg       840
     atggccgaca cctttcaggc ggctctggag gccaagcgga ttacgctcga gcggcggctg       900
     cccgaagggc ccgtcctggt gcgggccgat tctgaccggc tggcccaggt gatcgggaac       960
     ctgctctcca acgccctggg tcacaccccg gccggggggt ggattgggct cgaggtggcc      1020
     gccgaggctg cgcaggcccg cttgcgggtg ctggacagcg gcccgggcat ccccgcggaa      1080
     gccctgaaca aggtcttcga ccgtttctac cgggccgagg cctcgcgctc cagggccacc      1140
     ggcggcagcg ggctggggct ctccatcgtc aaggccctgg tggagctgca caaaggaacg      1200
     gtgacggccc gcaaccgtcc cgagggcggg gcagttttcg aggtgcgcct gccgcttcat      1260
     caggccggtt ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page