(data stored in ACNUC7421 zone)

EMBL: CP001743.PE314

CP001743.PE314       Location/Qualifiers
FT   CDS_pept        285610..287397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0318"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor G domain protein; GTP-binding protein
FT                   HSR1-related; elongation factor Tu domain 2 protein;
FT                   InterProIPR000795:IPR000640:IPR002917:IPR004161:IPR
FT                   006298:IPR005225; KEGG: psa:PST_0355 GTP-binding protein
FT                   TypA; COGs: COG1217 membrane GTPase involved in stress
FT                   response; SPTR: A1HPG5 GTP-binding protein TypA; PFAM:
FT                   Elongation factor Tu GTP binding domain; Elongation factor
FT                   G C-terminus; Elongation factor Tu domain 2; TIGRFAM:
FT                   GTP-binding protein TypA/BipA; small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27096"
FT                   /protein_id="ADD27096.1"
FT                   /translation="MELRNIAIIAHVDHGKTTLVDAMLKQAKALSRHEAEGERIMDSND
FT                   LERERGITILAKNTAVEWGGVKINIVDTPGHADFGGEVERALSMVDGVLLLVDAAEGPM
FT                   PQTRFVLKKAIEAGLKPIVVINKVDKKDARPDEVLNETFDLMAELGASDEQLDFPYLYA
FT                   IGREGAAWLGDQPKPDLTDLFETILKHIPAPQVAQGPFQLRVANLDYSNFLGKIALGKV
FT                   HRGTVRKNQFVTIVGEHGNRDLKVVAVFTHRGLERLEVDEATPGDIVAIAGMEGVEIGD
FT                   TIAAREAPEALPRLAVDEPTVSITVTPNTSPFAGREGKYVTSRQIRERLLKELETNVAL
FT                   RVIEVTPDTFELHGRGELHLSVLLETMRREGFEFSVGQPSVLFKEIEGQIQEPYEYLVV
FT                   DVPEAKFGPVMEALGSRKAQMVHMEQESGRIRAEFTVPARALFGFRTMFLTLTAGEGVM
FT                   SHSFHAYGPHVGSLETRTTGSAVAMEAGVAYAYSLYRLQERVNFFIEPGTEVYVGMIVG
FT                   EHVRDNDLNVNVNINKKLTNVRAAGSDENIRLIPPRKFTLEEALEFLAPDELLEVTPQS
FT                   LRLRKRVLDPSQRKRAETV"
     atggaactca gaaacatcgc aattattgcg cacgtggacc acggtaagac caccctggta        60
     gacgcgatgc tcaagcaggc caaagccctc tcgcgccacg aggcggaggg cgagcgcatt       120
     atggactcca acgacctcga gcgcgagcgc ggcatcacca ttctggccaa aaacaccgcg       180
     gtggagtggg ggggcgtgaa gatcaacatc gtggataccc ccggccacgc cgattttggt       240
     ggcgaggtgg agcgcgcgct ttcgatggtg gatggggtgc tgctcctggt ggacgctgcc       300
     gagggcccca tgccccagac ccgcttcgtg ctcaagaagg ccatcgaggc cggcctcaag       360
     cccatcgtgg tgatcaacaa agtggacaag aaagacgccc ggcccgacga agttctaaac       420
     gagaccttcg acctgatggc cgagctgggg gcctccgacg aacagctcga cttcccctac       480
     ctctacgcca ttggccgcga gggcgcggcc tggctgggcg accagcccaa gcccgacctg       540
     accgaccttt tcgagaccat cctcaagcac atcccggccc cccaggtggc ccagggcccc       600
     ttccagcttc gggtggccaa cctcgactac tccaactttt tgggcaagat tgccctgggc       660
     aaggtgcacc gcggcacggt gcgcaaaaac cagtttgtga ccatcgtggg ggagcacggc       720
     aaccgcgacc tcaaggtggt ggcggtgttt acccatcggg gcctggagcg cctcgaggtg       780
     gacgaggcca cccccggcga tatcgtggcc atcgccggga tggaaggcgt cgagattggc       840
     gataccatcg cggcccgcga agcccccgag gccctgcccc gcctggcggt ggacgagccc       900
     acggtgagca tcaccgtgac ccccaacacc tcgcccttcg ccgggcggga gggtaagtac       960
     gtgaccagcc gccagatccg cgagcggctg ttgaaggagc tcgagaccaa cgtggccctg      1020
     cgggtcatcg aggtcacgcc cgataccttc gagctgcacg ggcgcggcga gctgcacctg      1080
     tcggtgctgc tcgagaccat gcggcgcgag ggcttcgagt tctcggtggg ccagcccagc      1140
     gtgctgttca aagagatcga gggccagatt caagaaccct acgagtacct ggtggtggac      1200
     gtgcccgagg ccaaattcgg cccggtgatg gaggccctgg gcagccgcaa ggcccagatg      1260
     gtacacatgg agcaggaatc ggggcgcatt cgggccgagt tcaccgtacc ggctcgagcc      1320
     ctgttcggct tccgcaccat gttccttacc ctcaccgcgg gggagggggt gatgagccac      1380
     agcttccacg cctacgggcc gcacgtgggc agcctggaaa cccgcaccac cggcagtgcg      1440
     gtggcgatgg aggccggcgt ggcctatgcc tacagcctgt accgcttgca ggagcgggtc      1500
     aattttttca tcgagcccgg caccgaggtg tacgtgggca tgatcgtggg cgagcacgtg      1560
     cgcgacaacg acctgaacgt caatgtcaac atcaacaaaa agctcaccaa cgtgcgggcc      1620
     gccggctccg atgagaacat ccgcctgatt ccgccgcgca agttcaccct ggaggaggcg      1680
     ctggagttcc tggcccccga cgagcttctg gaagttaccc cccaaagcct gcgcctgcgc      1740
     aagcgggtgc tcgaccccag ccagcgcaag cgggctgaga cggtttag                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page