(data stored in ACNUC7421 zone)

EMBL: CP001743.PE315

CP001743.PE315       Location/Qualifiers
FT   CDS_pept        287571..288392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0319"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SPTR: A0NN65 Putative uncharacterized protein; InterPro
FT                   IPR012307; COGs: COG1082 Sugar phosphate
FT                   isomerase/epimerase; KEGG: hypothetical protein; PFAM:
FT                   Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27097"
FT                   /protein_id="ADD27097.1"
FT                   /translation="MKPPLPVLGLALPIERLLEFRPWLLEHGGRDLELQDAVRPEVLDG
FT                   DWQPLVARARQALDGYTGRLGIHGPYDGLWMASFDPFVRRMIAERYRRALEFAADLGAS
FT                   HMVIHSPFLFFGHPQMAHTPGNGLEREIEWVHDTLQTVLPLARNLGLVLVIENIRDTNP
FT                   QPLRTLVQSFGSEQVRMSLDVGHAHLMQQLGGPAPDQWVKEAGPLLAHLHLQDNDGLLD
FT                   RHWSPGQGGVNWRALFAALQTLPSQPRLILEVRHEQLPVAAQWLVAQGLAC"
     atgaaacccc cgctgcccgt gctcggcctc gccctgccca tcgaacgcct gctcgagttt        60
     cgcccctggc ttctggagca cggagggcgc gacctcgagc tacaggatgc ggtgcgcccg       120
     gaggtgctgg acggcgactg gcagcccctg gtggcccggg cccggcaggc cctggacggc       180
     tacaccgggc gactggggat tcacggcccc tacgacggcc tctggatggc ctccttcgac       240
     ccctttgtgc ggcggatgat cgccgagcgc taccggcggg ccctggagtt tgccgccgac       300
     ctgggggcca gccatatggt cattcacagt ccttttctat tcttcggcca cccccagatg       360
     gcgcatacgc ccggcaacgg cctcgagcgc gagatcgagt gggtgcacga caccctccag       420
     actgtgctgc cgctggcccg caacctgggg ttggtgctgg tcatcgagaa catccgcgat       480
     accaacccac agcccctgcg caccctggtg cagtcgtttg gctccgagca ggtgcgcatg       540
     agcctggacg tgggccacgc ccacctgatg cagcagctcg ggggccccgc gcccgaccag       600
     tgggtcaaag aagccggccc gctgctggcc cacctgcacc tgcaggacaa cgacggcctg       660
     ctggatcgcc actggagccc cggccagggc ggggtcaact ggcgggccct gtttgcggcc       720
     ctccagaccc tcccaagcca gccccgcctc atcctggagg tgcggcatga gcaactgccc       780
     gtggccgctc agtggctggt agcgcagggg ctggcctgct ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page