(data stored in ACNUC7421 zone)

EMBL: CP001743.PE317

CP001743.PE317       Location/Qualifiers
FT   CDS_pept        289394..290218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0321"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A8RW82 Putative
FT                   uncharacterized protein; InterPro IPR000515:IPR001647;
FT                   COGs: COG0395 ABC-type sugar transport system permease
FT                   component; KEGG: mca:MCA1924 sugar ABC transporter,
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27099"
FT                   /protein_id="ADD27099.1"
FT                   /translation="MSSLPRWLARPLFYLLLGVYAWLLVLPLLSLLSASFRTEADLFTP
FT                   GLLPPQPTLEAYREALAKHPILRYLLNSLGVSLAITLGVLLTSATLGYALARVRFAGQS
FT                   LLFGFVVGLLLIPDEVTFLPRYLLVQELGWINSYWALIVPFLASPLGIFLMRQFLKSLP
FT                   QDLFDAARIDGAGHLRTLWYVALPLAAPALGALGALSFLGAWNMYLWPLVVINQNEMKT
FT                   AQIAIAQVQSVEVSSWNVVAAAAVLVLLPTLLAFLLAQRAFIRGIALGGLKG"
     atgagtagcc tgccccgttg gctggcccgc ccgttgtttt acctgctcct gggggtctat        60
     gcctggctgt tggtgctgcc gcttttgagc ctgctctcgg ccagttttcg caccgaagcc       120
     gacctcttta cccctgggct gctacccccc cagcccaccc tcgaggccta ccgggaagcc       180
     ctggccaaac accccatcct gcgctacctg ctcaacagcc tgggggtctc gctggccatc       240
     actttaggcg tgctgctgac ctcggccacc ctggggtatg ccctggcccg ggttcgcttt       300
     gccgggcaga gccttttgtt cggctttgtg gtggggctcc tgctcatccc cgacgaagtg       360
     accttcctgc cgcgctacct gctggtacag gaactgggct ggatcaacag ctactgggcg       420
     ctgatcgtgc cctttctggc ctcgccgctc ggcatcttcc tgatgcggca gttccttaag       480
     agcctgcccc aggacctgtt tgatgccgcg cggatcgacg gggccggcca cctgcggacg       540
     ctctggtacg tggccctgcc cctggccgcc ccggccctgg gggctttggg ggcgctgagc       600
     tttctggggg cctggaacat gtacctctgg ccgctggtgg tgattaacca gaacgagatg       660
     aaaaccgcgc agattgccat cgctcaggtg cagagcgtgg aggtctcgag ctggaacgtg       720
     gtggcggcgg cagcggtgct ggtgctgctg cccactttgc tggccttttt gctggcccag       780
     cgggccttta tccggggcat cgcgctgggc gggctgaagg gataa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page