(data stored in ACNUC7421 zone)

EMBL: CP001743.PE318

CP001743.PE318       Location/Qualifiers
FT   CDS_pept        290234..291541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0322"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: A8RW81 Putative uncharacterized protein; InterPro
FT                   IPR006059; COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; KEGG: bha:BH1079
FT                   glycerol-3-phosphate ABC transporter (glycerol-3-phosphate
FT                   binding protein); PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27100"
FT                   /protein_id="ADD27100.1"
FT                   /translation="MLRRWLILAGIALGGLGLAQQRITIDFWHSMGGVLGEATEALVKD
FT                   FNAAQNRVTVRSQFVGSYDDGLNKLRAALQAGGQGRPNVIQVYDIGARFMADSGAVLPL
FT                   EDLARANNFDLSQFVPQPRNYYTVDGKLYGLAFNSSNPILYFNAQALEQAGIPYRNTWS
FT                   LADLEAAARKLTIKDASGKTTRYGLSIPIDSWFMEQFSYNSGQYFCNNENGRKARATEV
FT                   TFNNPAAVAFLDTWARLVREGVAANTGRNWADSQSLFAQGNAAIAVYSTASLTGVLRQV
FT                   GNRFPVRTAFYPYLRERNGTAIGGAAVYLIRGFNDEQNAASWEFIRFLLRPETQAKWTI
FT                   ATGYFPVVKGVTELPSVRQAYVRQPNYTTAVRQLETSKVNTASAGCLMGGFTEIRQIVQ
FT                   SAIEEALRGKPAQQALDEAKQRADQVLARYNASVRP"
     atgctaagac gttggttgat tctggcaggc atcgcactgg gggggctggg tctggcccag        60
     cagcgcatca ccatcgactt ctggcactcc atgggcgggg tgctgggcga ggccaccgag       120
     gccctggtca aggactttaa cgctgcgcag aaccgggtta cggtgcgcag ccagtttgta       180
     ggctcctacg acgacggcct taacaagctg cgggcggctt tgcaggctgg ggggcagggc       240
     cggcccaacg tgatccaggt ctacgatatc ggggcccgct ttatggccga ctcgggcgcg       300
     gtcttgcccc tcgaagacct ggcccgcgcc aacaacttcg acctctccca gtttgtgccg       360
     cagccccgca actactacac cgtggacggc aagctgtatg ggctggcttt caacagctcg       420
     aatcccatcc tctacttcaa cgcccaggcc ctggagcagg ccggcattcc ctaccgcaac       480
     acctggagcc tggccgacct cgaggccgcc gcgcgtaagc tgaccatcaa agatgcctct       540
     ggcaagacca cccgctacgg cctctccatt cccatagata gctggttcat ggagcagttt       600
     agctacaact ccggccagta cttctgcaac aacgagaacg gccgcaaagc ccgggccacc       660
     gaggtgacct tcaacaaccc ggcggcggtg gccttcctgg acacctgggc ccgcctggtg       720
     cgggaagggg tggcggccaa caccgggcgc aactgggccg atagccagag cctgttcgcc       780
     cagggcaacg cggccattgc ggtgtactcc acggcctcgc ttaccggggt gctgcgccag       840
     gtgggcaacc gcttcccagt gcgcaccgcc ttctacccct acctgcgcga gcgcaacggc       900
     acggccattg gcggggcggc ggtctacctg atccgtggct ttaacgacga gcagaacgcg       960
     gcctcgtggg agttcatccg cttcctgctg cgccccgaga cccaggccaa atggactatt      1020
     gccaccggct acttcccggt ggttaagggg gtgaccgagc tgcccagcgt gcgccaggcc      1080
     tatgtgcgcc agcccaacta caccaccgcg gtaaggcagc tcgagacctc caaggtcaac      1140
     accgcttcgg cgggctgctt gatgggcggc ttcaccgaga tccgccagat cgtgcagtcg      1200
     gccatcgagg aggccctgcg gggcaagccg gcccagcagg ccctcgacga ggccaagcag      1260
     cgggccgatc aggtacttgc ccgctacaac gccagcgtcc ggccgtaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page