(data stored in ACNUC7421 zone)

EMBL: CP001743.PE319

CP001743.PE319       Location/Qualifiers
FT   CDS_pept        291664..292524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0323"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; InterPro IPR004810:IPR002912:IPR002376;
FT                   KEGG: abo:ABO_1563 formyltetrahydrofolate deformylase;
FT                   COGs: COG0788 Formyltetrahydrofolate hydrolase; SPTR:
FT                   O34990 Formyltetrahydrofolate deformylase; PFAM: ACT
FT                   domain; Formyl transferase; TIGRFAM: formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27101"
FT                   /protein_id="ADD27101.1"
FT                   /translation="MQSDTTARLLITCPDRPGIVAAVSNFLFNHGANITALDQHSTDPE
FT                   GGLFFMRLEFQTPHLDVSREILEKAFAERVAARFEMNWRIAYAADLKKVAILVSKYDHA
FT                   LLELLWRHSNRELPCTITQVISNHPDLRPEVERFGIPYHHVPVEKDRKEEAEAQILHLL
FT                   GDTDLVVLARYMQILTPQFVARYPHRIINIHHSFLPAFVGANPYKQAYMRGVKIIGATA
FT                   HYVTEELDQGPIIEQDVARVSHRHDVADLVRLGRDLERNVLARAVQWHLEDRIIVYGNK
FT                   TVVFS"
     atgcagtcgg ataccactgc acgccttctg attacctgcc ccgaccggcc cggcattgtg        60
     gcggcggtct cgaatttcct cttcaaccac ggggccaaca tcaccgcgct cgaccagcac       120
     tccaccgacc ccgagggggg gctcttcttc atgcggctgg agttccagac cccgcacctc       180
     gatgtgtcgc gggaaatcct cgagaaagcc tttgccgagc gggtggcggc ccgcttcgag       240
     atgaactggc gcatcgccta cgccgccgac ctcaagaaag tagccatcct ggtctccaaa       300
     tacgaccacg ccctgctgga gcttctctgg cggcacagca accgcgagct gccctgtacc       360
     atcacccagg ttatctccaa ccaccccgac ctgcggcccg aggtggagcg cttcggcatc       420
     ccctaccacc acgtgccggt ggagaaagac cgcaaagaag aggccgaggc gcagatcctg       480
     cacctgctgg gggataccga cctggtggtg ctggcccgct acatgcagat tctcaccccg       540
     cagtttgtgg cccgctaccc ccaccgcatc atcaacatcc accactcctt cctgccggct       600
     tttgtggggg ccaatcccta caaacaggcc tatatgcggg gcgtgaagat catcggggcc       660
     accgcccact acgtgaccga ggagctggat cagggcccca tcatcgagca ggacgtggcc       720
     cgggtctcgc accggcacga cgtggccgac ctggtgcggc tggggcgcga cctcgagcgc       780
     aacgtgctgg ctcgagcggt gcagtggcac ctggaagacc gcatcatcgt gtacggcaat       840
     aagaccgtgg tgttttcata a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page