(data stored in ACNUC7421 zone)

EMBL: CP001743.PE32

CP001743.PE32        Location/Qualifiers
FT   CDS_pept        complement(28422..29762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0033"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein;
FT                   InterProIPR004358:IPR003594:IPR003661:IPR003660:IPR 005467;
FT                   KEGG: sfu:Sfum_2006 integral membrane sensor signal
FT                   transduction histidine kinase; COGs: COG0642 Signal
FT                   transduction histidine kinase; SPTR: A6F2K0 Sensor protein;
FT                   PFAM: His Kinase A (phosphoacceptor) domain; HAMP domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26814"
FT                   /protein_id="ADD26814.1"
FT                   /translation="MSLRLRLALFIALAIALALLVQGFLGYASFERLQMGNLERDLNAY
FT                   LARIADQLEGRRGPPRLFRRDRDGDSGTEWMERLRDNTPPLPLPNPAPVGTIAHARLVQ
FT                   GQVVLREWGSFPDEIPLDNRPEARLEQNWLYRSVRLGPELYLQGALEASQVRASLAGYQ
FT                   QTVLFTALVVALLGAWVAWLVSGPALRPLRHLQQAARRVADSGDLSLRVPAEGSGELLH
FT                   LSQTFNQMLERLSAFRQRETEFTRNAAHELRTPLTSLRLQLDALQQGLASPEETLSVVR
FT                   EEVERMTHLSESLLTLAREGRGQRVGLDVAQLAQEVAQKAGVPYQGPLHLETSGDPFLL
FT                   RQALENLLSNAQKYAPGAPVRLELAHSDDHRFAILRVQDEGPGMPPEVLKRAAEPFYRA
FT                   PGTRVPGNGLGLSVAAQVAQVHEGRLELRNLEPRGLAAELWIRIQPA"
     atgagcctgc ggctgcgcct ggccctgttt atcgccctgg ctattgccct ggccctgctg        60
     gtgcaggggt ttttagggta cgccagcttc gagcgcttgc agatgggcaa cctcgagcgc       120
     gacctgaacg cctacctggc ccgcatcgcc gaccagctcg agggccgccg gggccccccg       180
     cggctattta ggcgcgatcg ggacggcgat tccggcaccg agtggatgga gcgcctgcgc       240
     gacaacacgc ccccgcttcc ccttcccaac cccgcgccgg tgggcaccat cgcccatgca       300
     cggctggtgc aggggcaggt ggtgctgcgg gagtggggga gtttccccga cgaaataccg       360
     ctggacaacc gccccgaggc ccggctcgag cagaactggc tctaccgtag cgtgcgcctg       420
     ggccccgaac tttacctgca gggggcgctc gaggccagcc aggtgcgggc cagcctggcc       480
     ggctaccagc agaccgtgct gttcaccgcc ctggtggtgg cactcctggg ggcctgggtg       540
     gcctggctgg taagcgggcc ggccctgcgg cccctgcgcc acctccagca ggccgcccgc       600
     cgggtggccg actcgggcga cctgagcctg cgggtgcccg ccgagggcag cggggagctc       660
     ctgcacctga gccagacctt caaccagatg ctcgagcggc tctcggcctt ccgccaacgc       720
     gagaccgagt tcacccgcaa cgctgcccac gagctgcgca cccccctgac ctcgctgcgc       780
     ttgcagctcg acgcactgca acaggggctg gcctcgcccg aggagaccct atcggtggtg       840
     cgggaggagg tggagcgcat gacccacctg agcgagtcgc tcctgaccct ggcgcgggag       900
     ggccgggggc agcgggtggg gctggacgtg gcccagctag cccaggaggt cgcacaaaaa       960
     gcgggcgtgc cctaccaggg gccccttcac ctggaaacct ccggcgaccc ctttctgctg      1020
     cgccaggccc tggaaaacct gctctccaac gcccagaagt acgccccggg ggccccggtg      1080
     cggctcgagc tggcccactc cgacgaccac cggttcgcca ttctgcgggt acaggacgaa      1140
     gggccgggca tgccgcccga ggtgctcaaa cgggccgccg agcccttcta ccgcgccccc      1200
     ggcacccggg tgccgggcaa cggcctgggc ctgagtgtgg cggcccaggt agcccaggta      1260
     cacgagggcc gcttggagct caggaacctc gagccccgcg ggcttgcagc cgagctgtgg      1320
     atccggattc aaccggcctg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page