(data stored in ACNUC7421 zone)

EMBL: CP001743.PE322

CP001743.PE322       Location/Qualifiers
FT   CDS_pept        296653..297855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0326"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="TIGRFAM: adenylosuccinate synthetase; PRIAM:
FT                   Adenylosuccinate synthase; PFAM: adenylosuccinate
FT                   synthetase; InterPro IPR001114; SPTR: Q5SLS1
FT                   Adenylosuccinate synthetase; KEGG: Os03g0174500;
FT                   hypothetical protein; K01939 adenylosuccinate synthase;
FT                   COGs: COG0104 Adenylosuccinate synthase; SMART:
FT                   adenylosuccinate synthetase; PFAM: Adenylosuccinate
FT                   synthetase; TIGRFAM: adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27104"
FT                   /protein_id="ADD27104.1"
FT                   /translation="MPGIAIIGAQWGDEGKGKVTDALAEDADFVVRYQGGANAGHTVVA
FT                   QGKTFKLNLLPTGVIHPQATNVLGDGMVIDAYRFAEEMQNIRAEGLNPRVLVSDKAHLV
FT                   LPHHKTVEARNNFVGTTKRGIGPAYSDRARRVGIRAGDLLNEAVLRERVETLLTEKPNS
FT                   TREAGWDTPEKALADLYRMREILAPHITDTGRLLREAIQQGKKVLFEGAQATLLDLNYG
FT                   DYPYVTSSHPTVGGIIVGAGVNHKAINKVYGVAKAYATRVGNGPFPTELFGEEDEYLRQ
FT                   KGGEFGVTTGRARRTGWLDLVLLKYACEVNGFDGLVLTKLDVLSGFPVVKVGVEHRPDG
FT                   SVKYAEIPGWGDLTGIQSREELPASLKQFIELVEDFTQTPVVMFSTSPRREDTFGAVSW
FT                   V"
     gtgccaggaa tcgccattat tggagcccag tggggtgatg aaggaaaagg caaagtaacc        60
     gatgccctcg ctgaagacgc cgattttgtg gtgcgctacc aggggggggc caatgcgggg       120
     cataccgtgg tggcccaggg caaaaccttc aagctgaacc tgctgcccac cggggttatt       180
     cacccccagg ccaccaacgt gctgggcgat gggatggtga tcgatgccta ccgctttgcc       240
     gaggagatgc agaacatccg ggccgaggga ctgaacccca gggtgctggt ctcggacaag       300
     gcccacctgg tgctgcccca ccataagaca gtggaggccc gcaacaactt tgtgggaacc       360
     accaagcgcg gtatcgggcc ggcctactcc gaccgggccc ggcgggtggg catccgcgcc       420
     ggcgatctgc tcaacgaggc agtgcttaga gaacgggtcg aaaccctgct gaccgagaag       480
     cccaactcga cccgagaagc gggctgggat acccctgaaa aagccctggc cgacctctac       540
     cggatgcgcg agatcctggc ccctcacatt accgacaccg gccgcctgct gcgggaggcc       600
     atccagcaag gtaaaaaagt cttgtttgaa ggggcccagg ccaccctgct tgacctcaac       660
     tacggcgact acccctacgt gaccagctcg caccccacgg tgggggggat tattgtgggg       720
     gcgggtgtga accacaaggc catcaacaag gtctatgggg tggccaaggc ctatgccacc       780
     cgggtgggca acggcccttt ccccaccgag ctttttggtg aggaggacga gtatttgcgg       840
     cagaaagggg gtgagtttgg tgtgaccacc gggcgggccc ggcgcaccgg ctggctcgac       900
     ctggtgctgc tcaagtacgc ttgcgaggtg aacggctttg atggcctggt gctcaccaag       960
     ctcgacgtgc tctcgggttt tccggtggtc aaggtgggtg tggagcaccg gccggacggt      1020
     agcgtaaagt acgcggaaat tcccggctgg ggcgacctga ccggcattca gagccgggag      1080
     gagctaccgg ccagcctgaa gcagtttatc gaactggtcg aagactttac ccagaccccg      1140
     gtggtgatgt tttctaccag cccgcgccgg gaggacacct ttggggcggt gagctgggtt      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page