(data stored in ACNUC7421 zone)

EMBL: CP001743.PE327

CP001743.PE327       Location/Qualifiers
FT   CDS_pept        302527..303726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1406 transcriptional activator
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27109"
FT                   /protein_id="ADD27109.1"
FT                   /translation="MVERSSYGEDPRLILELRSHYPAERTRYITLPPLSWAEARASMLS
FT                   NLPFAQAARLFLASGGSPGHLRELLAVPHNGTEMPLPQRVRAQVQLESRMLSLEARLAL
FT                   ERLSVHPGPYSQGLLDALEATPYLDELERRGWLIYAGQWQFSDDASRRVLYLGLQPGRR
FT                   QQYHRQAALQCAMEEQRMAEAYHRLMAGDTADWGTFVNTLPGWTRYGLKAWLGMHENLP
FT                   MGPSTGEAARGSELALLEEARFGQGFEVEGRHVRWMRTPSMSSASGIIWAAHDEPSLLH
FT                   LKGNAYVENPLGVGISGRAAPLMLEIQEPREARIIFLPGIQAGALADNALLLPLQEELD
FT                   VWFRVPAGASIRLTSSAESGLIDLEVTSYRVAPPPLAQSAPRVEVFEFFRSAVEAARKS
FT                   "
     gtggtggagc gctcctccta tggcgaagat cccaggctca tcctggagct gagaagccat        60
     taccccgccg agcgcacccg ctacatcacc ctgccgcccc tgtcctgggc ggaggcccgc       120
     gcttccatgc tttccaacct accctttgcc caggcggcgc ggctgtttct ggcctcgggg       180
     ggctcgcccg gccacctgcg ggagctgctg gctgtgcccc acaacggcac cgagatgccc       240
     ttgccccagc gggtgcgggc gcaggtgcag ctcgagtccc ggatgctgtc gctggaggcc       300
     cggctggccc tggagcgcct gtcggtgcac cccggccctt acagccaggg tctgctggac       360
     gccctcgagg ccacgcccta cctcgacgag ctcgagcgcc gtggctggtt aatttacgcc       420
     ggccagtggc agttttccga tgacgccagc cgccgggttc tgtacctggg gttgcagccc       480
     gggcggcgcc agcagtacca ccgccaggcc gccctgcagt gtgcgatgga ggagcagcgc       540
     atggccgagg cctaccaccg cctgatggcc ggggataccg ccgactgggg cacctttgtc       600
     aacaccttgc cgggctggac ccgctacggc ctcaaggcct ggctgggtat gcacgaaaac       660
     cttccgatgg gccccagtac cggcgaggcg gctcgaggca gcgaactggc cttgctggaa       720
     gaggctcgct ttggacaggg cttcgaggtc gaagggcgtc atgtgcgctg gatgcgcacc       780
     ccctccatga gcagcgcttc gggcattatc tgggcggcgc atgacgaacc ttcgctgctg       840
     cacctcaagg gcaatgccta cgtagagaac cccctggggg tgggcatctc ggggcgcgct       900
     gcccctctga tgcttgaaat tcaagaaccc cgcgaagccc gcatcatctt cctcccgggt       960
     attcaggcgg gggccctggc cgataacgcc ctgttgttgc ctttgcagga agagctggat      1020
     gtctggttcc gggtgccagc cggggctagc atccgcctga ccagcagcgc tgagagcggc      1080
     ctgatcgacc tcgaggtcac ctcctaccgc gtggcgccgc ctcctttggc gcagtcggct      1140
     cccagagtgg aggtattcga attttttcgt agcgcggtag aagccgccag gaaaagctaa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page