(data stored in ACNUC7421 zone)

EMBL: CP001743.PE33

CP001743.PE33        Location/Qualifiers
FT   CDS_pept        complement(29759..30421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0034"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; InterPro IPR001789:IPR001867; KEGG: psa:PST_2709
FT                   probable two-component response regulator; COGs: COG0745
FT                   Response regulators consisting of a CheY-like receiver
FT                   domain and a winged-helix DNA-binding domain; SPTR: A5XX47
FT                   DNA-binding response regulator; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26815"
FT                   /protein_id="ADD26815.1"
FT                   /translation="MRLLLVEDEPNIARPVLRALEAQGHQVRHAPDLTTARALLAEAEP
FT                   DLMILDVRLPESEDGGFILAREARAAGYKGPILFMTARDALADRVMGLDEGGDDYVVKP
FT                   FDLPELLARVRALLRRMSEVKQSRVQLGPLELDLADRSVRWEGRLVELSGREYALLERL
FT                   ALFPGRVYSPEELLDLIWGEEASDTGVVKVCVHHLRNKLDSRVVRTVPGGYRLGVEP"
     atgcggctct tgctggtcga agacgagccc aacatcgccc gcccggttct gcgggcgctg        60
     gaggcccagg ggcaccaggt gcgccatgcg cccgacctga ccacggcccg tgcgctgctg       120
     gccgaggccg agcccgacct gatgattctg gacgtgcgcc tgcccgagtc ggaggacggg       180
     gggtttattc tggcccgtga agcccgcgcc gccggctaca aaggccccat tctcttcatg       240
     accgcccgcg acgccctggc cgaccgggtg atgggtctgg acgaaggcgg tgacgactac       300
     gtggtcaaac ccttcgacct gcccgagctt ctggcgcggg tgcgggcttt gctgcgccgg       360
     atgagcgagg tcaaacaaag ccgggtgcag ttgggccccc tcgagctcga cctcgccgac       420
     cgcagcgtgc gctgggaggg gcggctggtg gagctatccg ggcgggagta cgcgctgctg       480
     gaacggctgg ccctgtttcc gggccgggtc tacagccccg aggagctgct cgacctgatc       540
     tggggggagg aagcctccga taccggggtg gtcaaggtgt gtgtacacca cctgcgcaac       600
     aagctggata gccgcgtggt gcgcacggtg ccggggggct accggctggg ggtggagcca       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page