(data stored in ACNUC7421 zone)

EMBL: CP001743.PE330

CP001743.PE330       Location/Qualifiers
FT   CDS_pept        complement(304992..305324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27112"
FT                   /protein_id="ADD27112.1"
FT                   /translation="MSWLVVFLALFVLIALFGLVNYWGYRRVEQAQQAWFRQMLGEGVD
FT                   LEAFLQSAPYEYRPLKGSKAYGIVDKRTGEEVYRVKTPEEAEAWIVTNTLAEQGKLPQA
FT                   GSEKSG"
     atgagctggc ttgtggtttt tctggccctc tttgtgctca tcgccctgtt tggcctggtc        60
     aactactggg gctaccggcg ggtcgagcag gcccagcagg cctggtttcg ccagatgctg       120
     ggggaggggg tggatctcga ggccttcctc cagtcggccc cttacgagta caggcccctc       180
     aagggcagca aggcctacgg catcgtggac aagcgcaccg gtgaggaagt ctaccgggtc       240
     aaaacccccg aggaggccga ggcctggatc gtgaccaaca ccctggccga gcagggaaag       300
     ctgccacagg ccgggtcgga aaagtcgggc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page