(data stored in ACNUC7421 zone)

EMBL: CP001743.PE331

CP001743.PE331       Location/Qualifiers
FT   CDS_pept        complement(305364..306329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0335"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; SPTR: A0ACG9 Putative
FT                   transcriptional regulator; InterPro IPR001034:IPR013196;
FT                   COGs: COG2378 transcriptional regulator protein; KEGG:
FT                   aba:Acid345_4546 transcriptional regulator, DeoR family;
FT                   PFAM: HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27113"
FT                   /protein_id="ADD27113.1"
FT                   /translation="MRADRLVSILLLLQTRGRATTAELAKRLEVSPRTIHRDMEALTAS
FT                   GVPVYAERGSKGGWRLLEEYRTNLTGLSQPEIMALFALKPTQLLRDLGLGKAGENALIK
FT                   MLAALPAAQRRGAEYARQRILVDIQRYQEKVPLLPVLQEAVWQDRKLRLVYEPMEGQPA
FT                   ERTVDPLGLVVKGSVWYLVASRQGELRSYRVSRILEASVLDEPSQRPADFDLEAYWHKA
FT                   RADFRAKIPSYRIWVRVQEKVLARSNPASHWGQLEHCKPAGDSWLKAQIRFEYPEQALG
FT                   WVLAAGAGVEALEPLEFRKQVLEALSKALALYQTQARPVS"
     atgcgggcgg atcgtctggt ttcgatactg ttgctgttgc agaccagagg gcgggctacc        60
     acggcagagc tggccaagcg cctcgaggtc tccccacgca ccatccaccg cgacatggag       120
     gccctcaccg cctcgggtgt accggtctac gccgagcggg gtagcaaggg ggggtggcgg       180
     ctcctggagg agtaccgcac caacctgact ggccttagcc agccggaaat tatggcgctg       240
     tttgcactca aacccaccca actcctgcgc gacctgggcc tgggcaaagc cggtgaaaat       300
     gcccttatca agatgctggc cgccctgcct gctgcccagc ggcggggggc cgagtacgcg       360
     cgtcaacgta ttctggtaga cattcagcgt tatcaggaaa aagttccctt gttgcctgtt       420
     ttgcaggaag cggtctggca agaccgaaag ctacggctgg tctacgaacc gatggagggg       480
     caaccggccg agcgcaccgt agacccgctg ggcctggtgg tcaagggaag cgtgtggtat       540
     ctggttgcct ccagacaggg cgaactgcgc tcgtaccgtg tttcgagaat cctcgaggcc       600
     agcgtgctgg acgaaccttc ccaacgccct gccgacttcg acctcgaggc ctactggcac       660
     aaagcccgcg ccgactttcg cgccaaaatt ccctcctacc gcatttgggt tcgcgttcaa       720
     gaaaaggtgc tggcgcgttc caaccctgcc agccactggg ggcagctcga gcactgcaag       780
     ccggcaggcg atagctggct gaaagcccag attcgcttcg aataccccga gcaagccttg       840
     ggctgggtct tggccgctgg cgccggggtg gaagccctcg agccgctcga gttccgcaag       900
     caggtgctcg aggcgctgag caaagccctg gcgttgtacc agacccaggc tcggcctgtg       960
     agctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page