(data stored in ACNUC7421 zone)

EMBL: CP001743.PE333

CP001743.PE333       Location/Qualifiers
FT   CDS_pept        307618..308586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0337"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="TIGRFAM: D-alanine/D-alanine ligase; PRIAM:
FT                   D-alanine--D-alanine ligase; PFAM: D-alanine--D-alanine
FT                   ligase domain protein; ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp; protein of unknown
FT                   function DUF201;
FT                   InterProIPR003135:IPR011095:IPR003806:IPR011127:IPR
FT                   011761:IPR000291:IPR005905; KEGG: pst:PSPTO_4182
FT                   D-alanyl-alanine synthetase A; COGs: COG1181
FT                   D-alanine-D-alanine ligase and related ATP-grasp protein;
FT                   SPTR: Q72IA9 D-alanine--D-alanine ligase; PFAM: ATP-grasp
FT                   domain; D-ala D-ala ligase N-terminus; TIGRFAM:
FT                   D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27115"
FT                   /protein_id="ADD27115.1"
FT                   /translation="MKVLLLAGGPPGEHEVSLSSARGVLAAMPHPTELVVIAKDGRWLL
FT                   GEDAYEALRAGVAEQGTHPFPPPVPWQHYDVVFPLLHGPLGEDGVIQGFLQLLRRPYVG
FT                   AGVASSALCMDKDLCKRVLRQAGIPVVPWVTLYKGEPTPQPPFPPPYFVKPANTGSSVG
FT                   ISKVKADQDATRALAEAFAWDDKVLVEQGIEGVRELEVALLGNIHAEASVVGEITYQSE
FT                   FYDYETKYTEGKAQLHLPAPIPPELSDEIRATALEAYRILGVRGMARVDFFLSPQGELY
FT                   LNEFNTIPGFTPTSMYPKLWQATGLAYPDLLDRLVRLALER"
     atgaaggtct tgctgctggc cggtggcccc cccggcgaac acgaggtctc gctctcctcg        60
     gcgcgggggg tgctggcggc catgccccac cccaccgaac tggtagtgat cgccaaagat       120
     ggcaggtggc tgctggggga ggacgcgtac gaagccctgc gggccggcgt ggctgagcag       180
     ggcacccacc ccttcccgcc ccccgttccc tggcaacact acgacgtggt ctttccgctg       240
     ctgcacggcc ccctgggcga ggatggggtg atccaggggt ttttacagct cctgcggcgg       300
     ccctatgtgg gggcgggcgt ggccagctcg gcgctgtgca tggacaagga cctctgcaag       360
     cgggtgctgc gccaggccgg tatcccggtg gtgccctggg tgaccctgta caaaggcgaa       420
     ccaacacccc agcccccctt ccccccgccc tactttgtaa agccggccaa caccggctcc       480
     tcggtgggca tctccaaggt caaggccgac caggacgcaa cccgagcgct ggctgaggct       540
     ttcgcctggg acgataaagt gctggtggag cagggcatcg agggggtgcg ggagctcgag       600
     gtggcccttt tgggcaacat tcatgccgag gccagcgtgg tgggtgagat tacctaccag       660
     tccgagttct acgactacga gaccaaatac accgagggca aagcccagct tcacctgccc       720
     gcccccatcc cccccgaact ctcggacgag attcgcgcca ccgccctcga ggcctaccgc       780
     atcctgggcg tgcgcgggat ggcccgggta gactttttcc tttcgcccca gggggagctt       840
     tatctcaacg agttcaacac catccctggc ttcaccccca ccagcatgta ccccaagctc       900
     tggcaggcca ccggcctggc ctaccccgac ctgctcgacc ggctggtgcg gctggccctc       960
     gagcgctga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page