(data stored in ACNUC7421 zone)

EMBL: CP001743.PE336

CP001743.PE336       Location/Qualifiers
FT   CDS_pept        311483..312466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0340"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; SPTR:
FT                   A3RNT4 Type I secretion adaptor protein (HlyD family);
FT                   InterPro IPR006143; COGs: COG1566 Multidrug resistance
FT                   efflux pump; KEGG: afr:AFE_2692 type I secretion membrane
FT                   fusion protein, HlyD family; PFAM: HlyD family secretion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27118"
FT                   /protein_id="ADD27118.1"
FT                   /translation="MSQGRLEWELPPARKSRWVLWLLLLILGILVVGAWLTPVQVYALA
FT                   SGALEPRGQVLRVLAPSGGRLVYVGVQPGQLVQKGQRLYTLDGLGSSPEEARLQLQTAM
FT                   AQAEEAVRTLAQVREQLAQRRRIAQIQTSLYQVGAIARVEYLEALENLRQAEAAVRVAE
FT                   ARVSTLRAQAQALKSRRNIHLNSPATGRILTLSSHRAGEPVMAGQVLAEVLPQDVPLVF
FT                   RAYLPERERPKLRAKAEAEVAWNAFPRQRFGTSRGTVERISPSTVVYNNQAVYEVEISL
FT                   PSLTLSSAEGTRQVVPGMLGEARIVAARRSALSLLWDWVRGVNPWG"
     atgagccagg gccgcctcga gtgggaactc ccgcctgccc gcaaaagccg ctgggtgctg        60
     tggctgctgc tcctaattct gggcatcctg gtggtggggg cttggctaac accggtgcag       120
     gtgtatgccc ttgcgtcggg cgcactggaa cccaggggcc aggtgctgcg ggtactggct       180
     ccttccggcg gacggctcgt ctatgtaggc gtacagcccg gccagctcgt gcaaaaagga       240
     cagcggcttt acaccctgga tggcctgggc agcagcccgg aggaggcccg cttgcagctt       300
     cagaccgcta tggcccaggc cgaagaagcc gtgcgaaccc tggcccaggt acgcgaacag       360
     ctcgcgcagc gtcggcgcat cgcgcaaatc cagaccagcc tttatcaggt aggggccatc       420
     gcgcgtgtgg agtacctcga ggccctggaa aacctgcgcc aagccgaggc tgctgtcagg       480
     gtggccgagg ccagggttag caccctgcga gcccaggccc aggccctcaa aagccgccga       540
     aacattcacc taaacagccc ggcgaccgga cgcatactca cgctctcgag ccaccgggcg       600
     ggcgagccgg tgatggcggg gcaggtgctg gccgaggtac tcccccagga cgtaccgctg       660
     gttttcaggg cctacctgcc cgagcgggaa cggcccaaac tgcgtgcaaa agccgaggcc       720
     gaggtggcct ggaacgcctt cccacgccag cgttttggca ccagccgcgg tacggttgag       780
     cgcatatccc ccagcacagt ggtttacaac aaccaagccg tatacgaggt agagatttcg       840
     ctgccctcgc taacgctctc cagcgccgag ggcacccggc aggttgttcc gggtatgttg       900
     ggcgaggcgc ggattgttgc ggcaaggcgc agcgcgttga gcttgctctg ggactgggta       960
     cggggggtga acccgtgggg atga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page