(data stored in ACNUC7421 zone)

EMBL: CP001743.PE339

CP001743.PE339       Location/Qualifiers
FT   CDS_pept        313622..314560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27121"
FT                   /protein_id="ADD27121.1"
FT                   /translation="MSLRRATKSIILLPHMLAVFGSLASVLSFIVSTDNDLGRSIAIAI
FT                   SSMLAFVGYYLPARDETPALPELILAFGVITVLLHLIMPPTVLSALAQVLCMIFLALMS
FT                   NRVKLFFLIKPKLSVVFLFLPISMFGSSFLMMNHWIAYNILKPHYLEYSGKAKTSHQFE
FT                   IRGSMVVANTWEEMLRLGTYLSGVTNPYLSGLLWASGHSLPEASRAGKTGVDVPNGNED
FT                   IFKIWVGLAFLCETTIYGAILLFILKLTGSFWNVLLIHMMTNLFGFSITVGPELLGILL
FT                   SGTFLALGGAWLVFQLRYLGARFSQTGPRFG"
     atgagtctcc gtcgagcaac caaatcaata atacttctgc ctcacatgct tgcggtgttt        60
     ggaagccttg catctgtact ttcgttcatc gttagtacgg acaatgatct agggagatct       120
     atagctatag ccattagctc aatgttggca tttgtaggct actatctccc tgcaagggac       180
     gagacaccag cattacctga gttgatactt gcatttggag taattactgt cttattgcac       240
     ttgattatgc caccaactgt tttgagtgcg ctagctcaag ttctctgtat gatttttctt       300
     gcactcatgt caaatagagt caagcttttt tttctgatca agccgaagct ttcagttgtt       360
     tttttgttct taccaatctc catgtttgga agctcattct taatgatgaa tcattggata       420
     gcatataaca ttttgaaacc gcactacctg gaatactctg gaaaagcaaa aactagtcat       480
     caattcgaaa tccgtggaag tatggttgtg gccaatactt gggaagaaat gttgcggtta       540
     ggtacatacc tgtcaggcgt aacaaacccg tatttgtccg gactgctttg ggcatcggga       600
     cattcgcttc cagaagcaag tagggctggt aagactggcg tagacgttcc aaatggcaat       660
     gaagatatat tcaagatatg ggttggactg gcctttttgt gtgagacaac gatttatggt       720
     gccatactgt tgtttatctt gaagctgacc ggctcattct ggaatgtctt actgatacac       780
     atgatgacca acctttttgg cttttctatt actgttggtc ctgagttgct aggcatatta       840
     ttgagtggaa catttcttgc cttgggtggt gcctggcttg tctttcagtt gaggtactta       900
     ggagccagat tttcacagac agggcctcga ttcggctag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page