(data stored in ACNUC7421 zone)

EMBL: CP001743.PE34

CP001743.PE34        Location/Qualifiers
FT   CDS_pept        30591..31055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_02263 protein GlcG"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26816"
FT                   /protein_id="ADD26816.1"
FT                   /translation="MNKTLKTLLVVSSLAVAGAFAQQTPAPQPTPMQPRAMQRMAAPKG
FT                   LIGNLYWSAAQFLGVTPAELAVLSGGTKTLAQVATDLGKTPAALEAALVTARNQAIDQA
FT                   VQAGRLTAEQANTLKASSQAVAKAFVAQPVQLRMGLGGRGDWDGPRGRGR"
     atgaacaaaa cgctaaaaac cctgttggtg gtctcgagcc tggcggtagc gggcgccttt        60
     gcccagcaaa ccccggcgcc ccagcccacc ccgatgcagc ccagggccat gcagcgcatg       120
     gccgcgccca agggcctgat tggcaacctg tactggagcg cggcccagtt cctgggggtc       180
     acccccgccg agctggcggt gctgagcggt ggtaccaaga ccctggccca ggtggccacc       240
     gacctcggca agaccccagc ggccctcgag gcggccctgg tcaccgcccg caaccaggcc       300
     attgaccagg ccgtgcaggc cgggcggctt actgccgagc aggccaatac cctcaaggcc       360
     agcagccagg ctgtggccaa ggcctttgtg gcccagccgg tgcaactgcg catgggcctg       420
     gggggccggg gtgactggga cggcccccgg gggcgggggc gctag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page