(data stored in ACNUC7421 zone)

EMBL: CP001743.PE340

CP001743.PE340       Location/Qualifiers
FT   CDS_pept        316317..318830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0345"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; InterPro
FT                   IPR001440:IPR013026; KEGG: glo:Glov_2533 TPR
FT                   repeat-containing protein; COGs: COG3629 DNA-binding
FT                   transcriptional activator of the SARP family; SPTR: B5IGG0
FT                   Archaeal ATPase family; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27122"
FT                   /protein_id="ADD27122.1"
FT                   /translation="MSVLSPSALELLATAPAVVVAPVGIGFAQTDLEAWAHKTRRRILR
FT                   DPAEFSGLAPTLILPQRRSDLERLNSSDPRDFLFLRESDLLFSHDEWQQAVSTQQTYAE
FT                   TGGWPEALALLQRIVLQPGESLVRHPLCVARLGSLLPKDIPREILAKAAQSPLLIPELY
FT                   GLLGLDDTSVAELYDRGLLYAQGSGLAMPKLLRLYLRGSIPAEVARFIEITLLASGHVT
FT                   AVLELLAEQGEWERYLRLLTETFSTALGNAYLREWLALVPPKYRDLPVYRYLATYLARF
FT                   AGHTTLMEKELVELLPLADDHLRPFVLNAYGVSLGMQARYEEAIEKFRECLESNSSRVE
FT                   GITGKVFHNLGVAFFHLGKLAQAQDALLRAASIYRQLGLFDQEAISLATLAPVELCLGN
FT                   PREAISLVERALPYMNKLAAESYLTAENLAKAWIMCGDISNAERHLLELPEPKRDLRSH
FT                   LVTKKRLGEVYLWKGRYAEAKQLVEEVLYSNFKDQEVLDDVHLLLSRIAFLEGKTEQAR
FT                   AHLNKVVRSVHAITESAWQGLINLDTAIAELRRLGMKFDLARLLLRKGDLASLREALEL
FT                   SRTYQYGLLLHHPHYAHLWRPLVLADKGARSVFPLQIGTFGSFEARLLGTKLDLSRFKT
FT                   RKSAVLLTYMALHPSAHNRDKLAELFWSDVSNPLASLNTAVSELRKLFDAPIMEGNKGQ
FT                   VWLAFPVQTDLADFTKSTEPFLKQPLLDPNQIGRLEAQLARFDAPWLPDFPDWFDEERT
FT                   FVEHRKAKLWRLLADFYATRAPHKAVAAYQRVTCLEPFNAEAWAGLMELYNTLGEKSLA
FT                   EQAQAAMHRAMRELFPFEPILCNQK"
     atgtccgttc tgagccccag cgccctcgag cttctcgcga ccgccccggc agtggtggtg        60
     gccccggtgg gtatcggctt cgcccagacc gatctagagg cttgggcgca caaaaccaga       120
     cgccgcatct tgcgcgaccc cgccgagttt tccggtctgg cacctactct aattttgccc       180
     caacgacgct ccgacttgga gcgcctgaac tcgagcgacc ctcgagactt tctttttctc       240
     cgtgaatccg atctactctt cagccacgac gaatggcagc aggccgtgag cacgcagcaa       300
     acctacgccg agaccggcgg ctggcccgag gcactggctc tgttgcagcg aatcgtccta       360
     cagcctggtg agtcgttggt gcgacatccc ctttgtgtgg ctcggctggg gtcgctgcta       420
     cccaaggata ttcctcgcga aattctagcc aaagcggccc aaagcccact tttaattccc       480
     gaactgtacg ggctgctagg tctagatgac acatccgttg ctgaactcta cgaccggggc       540
     ctgctttatg cccagggttc cggtttggcc atgcccaagc tgttgcggct ctacctacgg       600
     ggttctattc ctgccgaagt ggcccggttc atcgagataa cattgttggc cagtggtcat       660
     gtgacggctg tcctggagtt gctggccgag cagggtgaat gggaacggta cctgcggctc       720
     ttgactgaga cgttttcgac cgctcttggc aacgcctatc tgcgcgagtg gctggctctg       780
     gttccaccaa agtaccgaga tttgcctgtc tatcgttatc tggctaccta tctggctcgc       840
     ttcgcgggcc ataccacact catggaaaaa gagctggtgg agttgttgcc cttggccgat       900
     gaccaccttc gcccctttgt gcttaacgct tatggagttt ctctgggcat gcaagccagg       960
     tatgaagagg ccatcgaaaa gtttcgtgag tgcctcgaat ccaacagttc cagggtagaa      1020
     gggatcactg gaaaggtttt tcataacctg ggggtggcgt tttttcatct cggaaaatta      1080
     gcacaggccc aagatgcgct tttgcgtgca gcaagcattt atcgccaact tgggctattt      1140
     gatcaagaag ccatttccct ggcaaccttg gctccggtgg agctttgcct gggtaatccg      1200
     cgggaagcga tttcgctcgt cgagcgtgcc ctaccctaca tgaataagct ggcagccgag      1260
     agctatctca cagccgaaaa cttggccaag gcctggataa tgtgcggcga tatttcaaat      1320
     gcggaaaggc accttctcga gctacccgaa ccaaaaagag atcttcgcag ccatttggtc      1380
     accaagaaac gcttgggcga ggtgtattta tggaaggggc ggtatgcaga ggcaaaacag      1440
     ttggttgagg aggttttgta tagcaacttc aaggatcagg aagtcctgga cgacgtgcat      1500
     ttactgttga gccgtattgc ttttctggaa ggcaaaaccg agcaggctcg agcccatctg      1560
     aataaggtgg tgcggagtgt tcatgccatc accgagtcgg cctggcaagg cctgatcaac      1620
     ctcgacacag ccatcgccga gctacgtcgg ctagggatga agttcgattt agcccgactt      1680
     ctgcttcgca agggcgattt ggcttcttta cgagaggcgc tggagcttag tcgtacatac      1740
     cagtatggct tgctcttgca tcacccacat tatgctcacc tttggcggcc tctggtgttg      1800
     gccgataagg gtgcgcgaag cgttttcccg ttgcagatag gtactttcgg ttcttttgag      1860
     gccaggttat tgggtacaaa gcttgactta agccggttca agacccgcaa atctgcggtg      1920
     ttgcttacat atatggccct tcatcccagt gcacacaacc gggataaact ggccgagctg      1980
     ttttggagcg atgtctccaa tccgctggcc tccctcaaca ccgccgtctc cgagcttaga      2040
     aaactgttcg acgcgccgat catggagggt aataagggcc aggtatggct ggctttcccg      2100
     gttcaaaccg acctggcgga ctttactaag agcaccgaac cattcctgaa acagcccttg      2160
     ctcgatccaa accaaattgg ccgcctcgag gcccaactag cccgctttga tgcaccttgg      2220
     cttccagact ttccggattg gttcgatgaa gagcgcacgt ttgtggaaca ccggaaggcc      2280
     aaactttggc gattactggc cgatttttat gccactcgtg ctccgcataa ggcggttgct      2340
     gcctatcaac gagtgacctg cctcgagccc ttcaacgccg aggcttgggc cggcctgatg      2400
     gagctttaca acacacttgg cgaaaaaagc cttgctgaac aggctcaggc agctatgcat      2460
     agggctatgc gggagctctt tccatttgaa ccgatcttgt gtaaccaaaa atag            2514
//

If you have problems or comments...

PBIL Back to PBIL home page