(data stored in ACNUC7421 zone)

EMBL: CP001743.PE342

CP001743.PE342       Location/Qualifiers
FT   CDS_pept        complement(320274..320702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0347"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; SPTR: A0YQB3 Putative
FT                   uncharacterized protein; InterPro IPR009288; COGs: COG2105
FT                   conserved hypothetical protein; KEGG: stm:STM4411 putative
FT                   cytoplasmic protein; PFAM: AIG2-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27124"
FT                   /protein_id="ADD27124.1"
FT                   /translation="MNAPEAVFVYGTLKQGERNFQVSKAAGWLRSAEAYIEGFRLFHIP
FT                   RSEVRPYAYPGVVRGEGRVWGEVQWFADLAHALELLDELEDEGREYRRISATAYLSQQA
FT                   PQPCAVWVYTYPSLEAMRSVSGLWLPEGVWREQTQPKG"
     atgaatgctc cagaagcggt ttttgtctat ggcaccctca agcagggcga gcgcaacttc        60
     caggtctcga aagcggccgg ttggctgcgc tcagccgagg cctacataga aggtttcagg       120
     ctttttcata ttcccagaag cgaggtgcgc ccctatgcct acccgggggt ggtgcggggg       180
     gaggggcggg tctggggcga ggtgcagtgg tttgccgatc tagcgcacgc gctcgagctg       240
     ctcgacgaac tcgaggacga aggccgcgag taccggcgca tctccgccac ggcctacctg       300
     agccagcagg ccccgcaacc ctgcgcggtc tgggtgtata cctaccccag cctagaggcc       360
     atgcgaagcg tctcgggcct ctggctgccg gagggggtct ggcgtgaaca aacccagcca       420
     aaggggtaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page