(data stored in ACNUC7421 zone)

EMBL: CP001743.PE343

CP001743.PE343       Location/Qualifiers
FT   CDS_pept        complement(320760..321449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0348"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; InterPro IPR000415; KEGG:
FT                   sfu:Sfum_0229 nitroreductase; SPTR: A3CX61 Nitroreductase;
FT                   PFAM: Nitroreductase family; TIGRFAM: SagB-type
FT                   dehydrogenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27125"
FT                   /protein_id="ADD27125.1"
FT                   /translation="MDKHPGKVFYRLTRIFPGDELPGGRAPAAKVYANPLESVELAEPA
FT                   RDGGPAVWRVLSRVAPTTPKVGSSITQAELSQVLAPLAVRREGRGYPSAGGAYPLEVYL
FT                   AVQRLQDTFQGIYHYAAKQHQLEQLSSRFDPQSWRAALMDLEAVETSAALVVFSAVPER
FT                   SEAVFGLRGFRYALLEVGYAVGEVMVAATALGLQAYPAATFYDEEVRKLLALPEAEYPV
FT                   VVLLLGR"
     atggacaagc accccggcaa ggttttttac cgcctaacgc gcattttccc cggagacgag        60
     ctgccgggcg ggcgggcccc agcggccaag gtctatgcca acccgctgga gtcggttgag       120
     cttgcagagc cggcccgcga cgggggcccg gcggtgtggc gggtgctctc gagggtggcg       180
     cccaccaccc ctaaggtggg ctcctccatc acccaggccg agctttcgca ggtgctggcc       240
     ccgctggcgg tgcgccggga ggggcggggg tatccctcgg cggggggtgc gtatccgctc       300
     gaggtctacc tggccgtgca acgcctgcag gacaccttcc agggcatcta ccactacgcc       360
     gccaagcagc accagctaga acagctttcc agccgcttcg acccccaaag ctggcgggcc       420
     gccctgatgg atctggaagc ggtggagacc tcggccgccc tggtggtgtt tagcgccgtg       480
     ccggagcgct ccgaggccgt cttcgggctg cgcggcttcc gctatgcgct gctggaggtg       540
     ggctacgccg tgggcgaggt gatggtggcc gccaccgccc tggggttgca agcctacccg       600
     gctgccacct tctacgacga agaggtgcgc aagctccttg cgctacccga ggcggagtat       660
     ccggtggtgg tgctgttgct ggggcggtaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page