(data stored in ACNUC7421 zone)

EMBL: CP001743.PE35

CP001743.PE35        Location/Qualifiers
FT   CDS_pept        31166..31426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2741 hypothetical protein; SPTR:
FT                   Q46BC1 Putative uncharacterized protein; PFAM: Predicted
FT                   membrane protein (DUF2078)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26817"
FT                   /protein_id="ADD26817.1"
FT                   /translation="MWMMDYRGRWDGFGYYGFGWMDDVLWALLLLGLIALVAVLIVRLL
FT                   RSPTNGSKAAPDRALEIARERYAKGEISQAEFETLKKNLSG"
     atgtggatga tggattaccg tggacgttgg gatggctttg gctactacgg ctttggctgg        60
     atggacgatg tgctgtgggc cctgctgttg ctcggactga ttgcgctggt ggcggtgctg       120
     attgtgcgac tgttgcgcag ccccaccaat ggcagcaaag cggcccccga ccgggccctg       180
     gagatcgccc gcgagcgcta tgccaaaggc gagatcagcc aggccgagtt cgagaccctc       240
     aagaagaacc tgagcggata g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page