(data stored in ACNUC7421 zone)

EMBL: CP001743.PE351

CP001743.PE351       Location/Qualifiers
FT   CDS_pept        complement(332280..333395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0356"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PRIAM: Glutamine--scyllo-inositol transaminase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; aromatic amino
FT                   acid beta-eliminating lyase/threonine aldolase; Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; InterPro
FT                   IPR000653:IPR001597:IPR000277; KEGG: aeh:Mlg_0663
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; COGs: COG0399
FT                   pyridoxal phosphate-dependent enzyme apparently involved in
FT                   regulation of cell wall biogenesis; SPTR: P15263
FT                   Pleiotropic regulatory protein; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27133"
FT                   /protein_id="ADD27133.1"
FT                   /translation="MSTLTQIPILDLKAEVDELWDELNAAIQRVLRSTQFIMGPEVQAL
FT                   EQQLAQYLGVKHAVALNSGTDALVIGLRALGVGPGDEVITSPFTFFATAEAISLLGARP
FT                   VFVDIDPQSFNLDPAGLEAAISPQTRAIIPVHLYGNPAAMGPILEIARRHGLKVLEDCA
FT                   QSFGARYEPLHRFTGTLGDAGAFSFFPSKNLGAYGDGGLLVTADDAVAEQARMLRAHGS
FT                   RKKYHNEVVGYNSRLDTLQAAILLVKLPHLERYNQARRAIAQRYNEGLAGLEGLIPPAL
FT                   TPGHVFHQYTVRILGNRRDAVQARLAELGIGTMVYYPVPLHRLPIYQPLGLHLPESERA
FT                   AAEVLSLPIWPQMQPEAQRAVIEAVRAAVQG"
     gtgagcaccc taacccagat tcccatcctc gacctgaagg cagaggtaga cgagctgtgg        60
     gacgagctca acgcggccat ccagcgggtc ttgcgctcga cccagttcat catggggccg       120
     gaagtacagg ccctcgagca gcagctcgcc cagtacctgg gggtcaaaca cgccgtggcc       180
     ctgaactccg gcaccgacgc cctggttatc ggcctgcggg cgctgggggt ggggcctggg       240
     gacgaggtga tcaccagccc ctttaccttt ttcgccaccg ccgaggccat cagcctgttg       300
     ggggccaggc cggtgtttgt ggacattgac ccccagagct tcaacctgga tcccgccggg       360
     ctcgaggccg ccatctcacc ccagaccagg gccatcattc cggtgcacct gtacgggaac       420
     cccgcggcca tgggcccgat tctggaaatc gcccggcggc acggcctgaa ggtgctggaa       480
     gactgcgccc agtcctttgg tgcccgctac gaacccctgc accgctttac cggaaccctg       540
     ggcgatgcag gggctttctc cttcttccct tccaaaaacc tgggggccta cggcgatggg       600
     ggtttgctgg ttaccgccga cgacgctgta gccgaacagg cccggatgct gcgggcccac       660
     ggctcgcgca agaagtacca caacgaggtg gtggggtata actcgcggct ggacaccctg       720
     caggccgcca tcctgctggt caagctgccc cacctcgagc gctacaacca ggcccgccgg       780
     gccatcgccc agcgctacaa cgagggcctg gccggcctcg agggcctcat ccccccggcc       840
     ctgacccccg ggcatgtctt ccaccagtac accgtgcgga ttctgggcaa caggcgcgat       900
     gccgtacagg cccggctggc cgagctgggc atcggcacca tggtctacta cccggtgccg       960
     ctgcacaggc tgcccatcta ccagcccctg ggactgcacc tgcccgaaag cgagcgggcc      1020
     gccgccgagg tgctctcgct gcccatctgg ccgcagatgc aaccagaagc ccagcgggcc      1080
     gtgattgaag ccgttcgcgc cgcggtgcag ggctag                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page