(data stored in ACNUC7421 zone)

EMBL: CP001743.PE353

CP001743.PE353       Location/Qualifiers
FT   CDS_pept        complement(333972..334916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0358"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; SPTR: A3SJ11 MviM protein; InterPro
FT                   IPR000683:IPR004104; COGs: COG0673 dehydrogenase and
FT                   related protein; KEGG: glo:Glov_1510 oxidoreductase domain
FT                   protein; PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27135"
FT                   /protein_id="ADD27135.1"
FT                   /translation="MKNFALIGAAGYIAPRHLKAIKDTGNRLVAALDPFDSVGIMDSYF
FT                   PEAEFFTQPELFEDYLYRLRGTPQQVDYVSIASPNYLHNAHIRMALRAGADAICEKPLV
FT                   LNPEEIRELKDLEAETGRRVWTILQLRTHEALLSLHARLQAQPPRKYQLDLTYITSRGT
FT                   WYLRSWKGRTEQSGGLATNIGVHFFDMLTWLFGKVEQVEVHRRDDTVASGYLELERAQV
FT                   RWFLSIDVEYVPPALRAQGKRTYRSMRLDGEEIEFSEGFTELHTRVYERTLAGQGFGLE
FT                   DTYEAIATVARIRTLPLSDRTATMHPFLQKVKQ"
     atgaagaact ttgcactcat cggcgctgcg ggctacatcg cgccccgcca cctcaaggcc        60
     atcaaggata ccggcaatcg ccttgttgcc gccctcgacc ccttcgattc ggtgggcatc       120
     atggactcgt acttccccga agccgagttt tttacccagc ccgagctgtt cgaggactac       180
     ctctaccgcc tgcgcggcac cccccagcag gtggactacg tgagcatcgc cagccccaac       240
     tacctgcaca acgcccacat ccgcatggcc ctccgggccg gggccgacgc catctgcgag       300
     aagcccctgg tgctcaaccc cgaggaaatc cgggaactca aggacctcga ggccgagacc       360
     gggcggcggg tctggaccat cctgcagctc cgcacccacg aggctctgct cagcctgcat       420
     gcccgcctgc aagcccagcc cccccgcaaa taccagctcg acctcaccta catcaccagc       480
     cggggcacct ggtacctgcg gagctggaag ggccgcaccg agcagtcggg gggcctggcc       540
     accaacatcg gggtgcactt cttcgatatg ctcacctggc tttttggcaa ggtggagcag       600
     gtggaggtgc accgccgcga cgacaccgtg gcctcgggct acctggagct cgagcgggcc       660
     caggtgcgct ggttcctttc gattgacgtg gagtatgtgc ccccggccct gcgggcccag       720
     ggcaagcgca cctaccgctc catgcgcctg gacggcgagg agatcgagtt ctccgaaggc       780
     tttaccgagc tgcacacccg cgtctacgag cgcaccctgg ccggtcaggg cttcggcctc       840
     gaggatacct acgaagccat cgccaccgtg gcccggatcc gcaccctgcc cctatcggat       900
     cgcaccgcca ccatgcaccc tttcctccag aaggtcaagc agtag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page