(data stored in ACNUC7421 zone)

EMBL: CP001743.PE356

CP001743.PE356       Location/Qualifiers
FT   CDS_pept        complement(337744..338769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: P94576 Uncharacterized protein ywoF; InterPro
FT                   IPR010916; KEGG: pna:Pnap_3111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27138"
FT                   /protein_id="ADD27138.1"
FT                   /translation="MFGIPSGPTYYVSPSGSNANDGSRERPWATLSFAVQKLKPGDVLR
FT                   VLPGSYNESVQVTASGTSSQRITIASDIRWGAKLNAQGNLFGIDVRGSYVDIVGFEVTN
FT                   ATNSGIISWAPYNRFLFNHVYGIRAQCDSNGGAGINASQPNAGNTSILSNLVHDIGDLT
FT                   AGPCTRIHGIYQGSPKGIIQNNIIYRARGFGITTWQAATAVVMTHNLSFANLYGGISVG
FT                   SGENTLGNKAENFLVANNIVVSNPRGISEENNTGVNRFLNNLVWNNTTNWALLTSSQQN
FT                   SLTEDPRFVNFKADGSGNYYLSNDSPAIDKGIREAAPSFDFMGHPRILGIAPDLGPLET
FT                   R"
     gtgttcggca ttcccagcgg ccccacctac tacgtaagcc cctccggcag caacgccaac        60
     gacggctccc gcgaacgccc ctgggccacc ctctccttcg ccgtgcagaa acttaagccc       120
     ggcgatgtcc tgcgggtgct cccaggctcc tacaacgagt ctgtccaggt taccgcctcc       180
     ggtacgtcca gccagcgcat caccatcgcc tccgatatcc gctggggcgc caaactcaac       240
     gcccagggca atctcttcgg tattgatgtc cgcggcagct acgtggatat cgtcgggttc       300
     gaagttacca acgccaccaa cagcggcatt attagctggg ccccctacaa ccgcttcttg       360
     ttcaaccatg tctatggcat ccgggcccag tgtgactcca acggcggggc cgggattaac       420
     gccagccagc ccaacgccgg caacaccagc attttgagca acctggtgca tgatataggc       480
     gatctcaccg caggcccctg cacccgcatc cacggcatct accagggaag tccaaaaggc       540
     attattcaaa acaatattat ttaccgtgcc cggggctttg gcatcaccac atggcaggcc       600
     gccacggctg tggtgatgac ccataacctc tcttttgcca acctatatgg tggcatctcg       660
     gtgggctcag gcgaaaatac cctcggcaat aaagctgaaa acttcctggt agccaacaac       720
     attgtagtga gcaacccccg tggcatcagc gaggaaaaca acaccggggt taatcgattt       780
     ttgaacaacc tggtctggaa caacaccacc aactgggctc tgctcaccag cagccagcaa       840
     aacagtctga ctgaagatcc ccgctttgtt aacttcaaag ccgacggctc tggcaactac       900
     tatctgagca acgatagccc agccatcgac aaaggcattc gtgaggccgc acctagcttt       960
     gatttcatgg gccacccccg catcctgggg atagctcccg accttggccc cttggaaacc      1020
     cgctaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page