(data stored in ACNUC7421 zone)

EMBL: CP001743.PE357

CP001743.PE357       Location/Qualifiers
FT   CDS_pept        complement(339065..339850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0362"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein;
FT                   InterPro IPR003856; KEGG: pde:Pden_0846 lipopolysaccharide
FT                   biosynthesis; PFAM: Chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27139"
FT                   /protein_id="ADD27139.1"
FT                   /translation="MRSTSSINDFDRLLLSFSRYMWALLGVSVLIAVVAYLLSISQPRI
FT                   YEASARLLSAQPVELGSTISAPRFQPLAAAAYREAAYGTLVLEQMNRRFPGVLPSEVAK
FT                   VREKLRIRSIETVGSSSIVFVLSARDSDPRRSAALANAWAEALRNWEEALIRDNFKRAS
FT                   VSLENRIRWVDIQITQAASRTDQNILRELRTNLERELGIIRSLENSATGQLSLLAQAEV
FT                   PTEAIWPRPLLTAGIAAISTLLLGFILLAVRDRLLGPTG"
     atgagaagca catccagcat aaatgatttc gatcgcttac tcctgagctt tagccgctac        60
     atgtgggcat tgctaggggt ttcggtgtta attgcggtgg tagcttacct gctaagcata       120
     tcccagccac gtatctacga agcctcggcc cgtttgcttt cagcccagcc ggtcgaacta       180
     ggttctacta tcagcgcgcc acggttccag cccctagccg cagccgctta ccgcgaagct       240
     gcctacggaa ctctagtact ggagcagatg aaccgtcgct ttcctggtgt attaccaagc       300
     gaagtggcga aagtacggga gaagttgcgt atccgctcta tcgagacggt aggctcgagt       360
     tccatcgttt ttgtactgag cgcccgcgat tccgaccccc gccgctctgc ggccttagcc       420
     aacgcctggg ccgaagcttt gcgcaactgg gaagaagccc tgattcgaga caacttcaaa       480
     cgtgccagcg tctcactgga aaaccggatt cgttgggtag atatccagat tacccaggct       540
     gctagtcgca ccgatcaaaa catcttgcgg gagttgcgta ccaacctcga gcgtgaactg       600
     ggaatcatac gctcgctgga aaacagcgcc accggccagc tctcactcct agcccaggcc       660
     gaagtgccca ccgaagctat atggccgcgt cctttgctca ccgctggcat tgctgctatc       720
     tccaccctgc tgctcggatt tatcctgctg gctgttcgag atcggttgtt aggccccact       780
     ggatag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page